1584 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

Histone deacetylase (HDAC) enzymes act as transcriptional repressors of genes through the deacetylation of lysine residues on histone proteins

Supplier: Anaspec Inc

Histone acetyltransferases (HATs) enzymes regulate the acetylation of histones and non-histone proteins

Supplier: Anaspec Inc

This 36-residue synthetic peptide strongly inhibits HIV-1 viral fusion with CD4 cells with an EC50 of 1 ng/ml.
It is a peptide mimetic of an essential region within the viral envelope glycoprotein gp41 that functions by blocking gp41 structural rearrangements at a transitional pre-fusion conformation.
Sequence:Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
MW:4492 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:5-FAM-P-Cha-G-Nva-HA-Dap(QXL™ 520)-NH2
MW:1567.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a fragment of the JAG-1 protein. JAG-1 is Notch ligand, a peptide that is the most conspicuously expressed ligand in skin. JAG-1 induces epidermal maturation. Exposing submerged keratinocytes monolayers to JAG-1 with elevated calcium concentration produces stratification with loricrin expression and NF-κB activation.
Sequence: CDDYYYGFGCNKFCRPR
MW: 2107.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Chromogenic substrate for Kallikrein 3, commonly known as prostate specific antigen (PSA)
Sequence:Suc-RPY-pNA
MW:654.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a universal Bombesin synthetic ligand, binding to all 3 bombesin receptors.
Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior. Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:yQWAV-(ß-A)-HF-Nle-NH2
MW:1298.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Besides water-soluble collagen (Type I) conjugate (Cat#85111), AnaSpec also offers water-insoluble fluoresceinated collagen (type I). It can also be used for fluorometric measurement of collagenase activity. Cat#85102 is the water-insolulbe collagen that is heavily labeled with FITC, resulting in almost total quenching of the conjugates fluorescence. Protease-catalyzed hydrolysis slowly yields brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. Although this fluoresceinated collagen is more slowly digested by MMP-1 than water-soluble collagen (Cat#85111), it is more specific for the enzyme.

Supplier: Anaspec Inc

Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.

Supplier: Anaspec Inc

The recombinant human α-synuclein (1-140) (GenBank Accession # NP_000336) was expressed and purified from E. coli and conjugated with biotin. Recombinant protein is produced without an affinity tag.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-RPLALWRK(5-FAM)-NH2
MW:1889.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34 tri-methylated at Lys-27.
Sequence:KAAR-K(Me3)-SAPATGG
MW:1156.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Like neuropeptide Y (NPY) and other peptides of the family, this peptide adopts a folded hairpin structure with the terminal segments in close proximity. An intracerebroventricular injection of NPY or [Leu31, Pro34]-NPY (non-Y2 receptor agonist) given during middle cerebral artery occlusion increases the infarct volume and nitric oxide (NO) overproduction in the rat brain.
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
MW:4240.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Aß (1-28) is highly hydrophilic and shares sequences with bA4, the major component of Aß. Its assembly is fibrillar, i.e., elongated in a single direction. Reports show that synthetic peptides Aß (1-40) and Aß (1-28) have significant effects on normal human plasma cholesterol esterification rate.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK
Molecular Weight: 3262.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Gastrin-1 is also referred to as Gastrin-17 or “Little Gastrin.” Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach. Secreted by the G cells in the gastric mucosa, it is one of the major bioactive forms of gastrin found in tissue and plasma (the other bioactive form is Gastrin-34 or Big Gastrin - Cat# AS-20747). Both Gastrin-17 and Gastrin-34 are carboxy-amidated and partially tyrosine sulfated. Binding of Gastrin to the CCK2/gastrin receptor requires carboxy-amidation, however sulfation is not necessary for binding to the receptor. Binding of Gastrin to the CCK2/Gastrin receptors on parietal cells of the stomach causes them to secrete hydrochloric acid (HCl) and stimulates lectin-like protein Reg expression via activation of PKC and RhoA. Gastrin also plays a role in release of Histamine and Pepsinogen.
Sequence: Pyr-GPWLEEEEEAYGWMDF-NH2
MW: 2098.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This peptide sequence with nine arginines contains a biotin group attached to the epsilon amino group of lysine at the N-terminus.
Sequence:Biotin-LC-RRRRRRRRR-NH2
MW:1762.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The SensoLyte® Green Protease Assay Kit is widely used for detection of generic protease activities. The kit uses a casein derivative that is heavily labeled with a rhodamine derivative, resulting in almost total quenching of the conjugate's fluorescence. Protease-catalyzed hydrolysis relieves this quenching conjugate, yielding brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity (Ex/Em=488/520 nm). The SensoLyte® protease assay kits do not require any separation steps and can be used to continuously measure the kinetics of a variety of exopeptidases and endopeptidases.

Supplier: Anaspec Inc

Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.

Supplier: Anaspec Inc

This is a fluorescent (TAMRA)-labeled Angiotensin II, Abs/Em = 541/565 nm.
Sequence: TAMRA-DRVYIHPF
MW: 1458.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Bovine ß-Casein, monophosphopeptide (phospho-Serine) can be used for characterization of affinity purified phosphorylated peptides in liquid chromatography and for the analysis or detection of phosphorylated peptides in mass spectrometry.
Sequence:FQ-pS-EEQQQTEDELQDK
MW:2062 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, but is devoid of any pore-forming activity. Apidaecins are the most prominent components of the honey bee humoral defense against microbial invasion.
Sequence:GNNRPVYIPQPRPPHPRL
MW:2108.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 647 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dye.

Supplier: Anaspec Inc

This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is a fluorescent plasmin substrate, Abs/Em=380/500 nm.
Sequence:vLK-AFC
MW:569.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3369.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is one of the predominant amyloid peptide structures deposited in human brain of Alzheimer’s disease and Down’s syndrome patients.Sequence: Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4309.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography. GST tag was not removed. The molecular weight of the recombinant GST-DJ-1protein is 47.3 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Supplier: Anaspec Inc

PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C