1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGSGAKKTSFRRAKQ
MW:2182.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

M-13 is a peptide that represents CAM-binding domain of Calmodulin (CaM) target proteins. CaM is an ubiquitous Ca2+ binding protein.
Sequence:KRRWKKNFIAVSAANRFKKISSSGAL
MW:2964.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb.
Sequence: SIINFEKL
MW: 963.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

The NGR (Asn-Gly-Arg) peptide motif is an aminopeptidase N (CD13) ligand that targets angiogenic blood vessels. NGR-containing peptides have been proven useful for delivering cytotoxic drugs, proapoptotic peptides and tumor necrosis factor (TNF) to tumor vasculature.
Sequence:CNGRCG (Disulfide bridge: 1-5)
MW:606.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H3 (1-30) acetylated at Lys14, Lys18, Lys23 and Lys27, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAP-GGK(Biotin)
MW:3802.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This novel fluorogenic substrate of HDACs was synthesized with an epsilon-acetylated lysyl moiety and an adjacent MCA moiety at the C-terminus of the peptide chain. The assay utilizing this substrate provides a good tool to characterize the HDAC activity. HDACs are important enzymes for the transcriptional regulation of gene expression.
Sequence:Ac-RGK(Ac)-AMC
MW:600.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3524 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is histone H3 (21-44) with deimination at Arg26, converting it to Cit (citrulline). It is biotinylated through a C-terminal GGK linker. Deimination by peptidyl arginine deiminase 4 (PADI4) blocks methylation by the CARM1 methyltransferase and inhibits transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAA-Cit-KSAPATGGVKKPHRYRPG-GGK(Biotin)
MW:2975.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H4 (1-23) monomethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me1)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2843.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This native Melan-A (26-35) decapeptide is an immunodominant antigen from melanocyte/melanoma (Melan-A/MART) protein that is more efficiently recognized by tumor-infiltrating lymphocytes (TILs) of melanoma patients than the Melan-A (27-35), but has lower binding affinity and stability than the ELAGIGILTV analog.
Sequence:EAAGIGILTV
MW:943.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 2Abz/Dnp FRET pair for quantitation of complement enzyme activity.
Sequence:2Abz-SLGRKIQIK(Dnp)-NH2
MW:1326.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 488 hydroxylamine is a carbonyl-reactive labeling dye, which reacts more readily with aldehydes at physiological pH than other primary amine-containing reagents (such as hydrazides and amines).

Supplier: Anaspec Inc

This peptide is amino acids 17 to 26 fragment of p53, the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence:ETFSDLWKLL
MW:1251.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Caloxin 1b1 is obtained by screening for binding to extracellular domain 1 of PMCA4, which inhibited PMCA extracellularly, selectively, and had a higher affinity for PMCA4 than PMCA1. Because caloxin 1b1 had been selected to bind to an extracellular domain of PMCA, it could be added directly to cells and tissues to examine its effects on smooth muscle and endothelium.
Sequence:TAWSEVLHLLSRGGG
MW:1582.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Group I of this 180 distinct peptide mixtures, in combination with Group II of 18 distinct peptide mixtures (cat# 62335), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of the different kinases. Amount provided is 1 mg of peptide mixture x 180 vials. Sequences: Y-A-Z-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-Z-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-Z-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-Z-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-Z-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-Z-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-Z-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-Z-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-Z-A-G-K-K(LC-Biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. Z = fixed position varied between the 20 natural amino acids.

Supplier: Anaspec Inc

This tumor antigenic peptide presented by HLA-A2 antigen to CTLs, is a tyrosinase fragment. Tyrosinase is a membrane-bound protein involved in the melanin synthesis pathway that is expressed by virtually all primary melanoma lesions and by most of metastatic lesions.
Sequence:YMDGTMSQV
MW:1031.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Aß (25-35) is the main factor responsible for Aß neurotoxic effects.

Supplier: Anaspec Inc

The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
This is a fluorescent (FITC)-labeled Antennapedia, Abs/Em = 493/522 nm.
Sequence:FITC-LC-RQIKIWFQNRRMKWKK-NH2
MW:2748.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is a fluorescent (FITC)-labeled Prototype of RGD-containing peptide, Abs/Em=492/516 nm.
Sequence:FITC-LC-GRGDSP
MW:1091.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Enterokinase is a heterodimeric serine protease produced by cells in the duodenal wall

Supplier: Anaspec Inc

Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

Supplier: Anaspec Inc

This is Oxytocin (OT) N-terminally labeled with Biotin. OT is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1234.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

ß-Secretase (BACE1) is a key enzyme involved in the production of Aß peptides found in extracellular amyloid plaques of Alzheimer’s disease (AD). The enzyme has been implicated as an excellent target for anti-amyloid therapy of AD. This statine-based substrate analog, beta-secretase inhibitor P10–P4’ statV, is used in the inhibition of beta-secretase activity from homogenized wild-type mouse cortices and from BACE-purified from human brain.
Sequence:KTEEISEVN-Sta-VAEF (Sta = statine)
MW:1651.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This epitope tag is a short hydrophilic, highly charged peptide. It is the most widely used epitope tag employed in structural and functional studies of proteins.
Sequence:DYKDDDDK
MW:1013 Da
% peak area by HPLC:95
Storage condition:-20° C