1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.
Sequence: NTWTTCQSIAFPSK
MW: 1583.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is a biotin labeled histone 3 (H3) fragment with amino acid residues 1 to 21. Lysine 9 is di-methylated.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)
MW:2637.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available. Its fluorescence emission maximum at 778 nm is well separated from commonly used far-red fluorophores such as HiLyte™ Fluor 647, HiLyte™ Fluor 680 or allophycocyanin (APC), facilitating multicolor analysis.

Supplier: Anaspec Inc

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
MW: 3766.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is the membrane-permeable postsynaptic density (PSD)-95-binding (decoy) peptide Tat-NR2Bct. It can transduce into neurons in cell culture.
Sequence: YGRKKRRQRRRKLSSIESDV
MW: 2518.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This C-terminally labeled biotin ACTH (1-39) has been used in ELISA assays. This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4768.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes. This sequence is a naturally presented Melan-A/MART-1 nonamer peptide. The Melan-A/MART-1 gene is expressed by normal melanocytes, as well as by most fresh melanoma samples and melanoma cell lines. This peptide appears to be a very common immunogenic epitope for HLA-A2-restricted melanoma-specific tumor-infiltrating lymphocytes (TIL) and may be useful for the development of immunotherapeutic strategies.
Sequence:AAGIGILTV
MW:814.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Excellent reagent for detecting polyhistidine-containing biomolecules

Supplier: Anaspec Inc

Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes, thymus, testis, lung, mouth mucosa, tongue, oesophagus, colon, caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach.
Sequence:GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
MW:3946.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Sequence:ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
MW:3442.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

26Rfa is a neuropeptide belonging to the RFamide peptide family. It exhibits orexigenic activity and has been associated to obesity. The primary structures of human, rat, and frog 26RFa exhibit 80% identity, and the C-terminal octapeptide is fully conserved from amphibians to mammals.
Sequence:ASGPLGTLAEELSSYSRRKGGFSFRF-NH2
MW:2820.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matriptase (also known as MT-SP1, ST14, TADG-15 and epithin) is a trypsin-like protease from the family of type II transmembrane serine proteases

Supplier: Anaspec Inc

MOG peptide fragment (35-55) induces autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination

Supplier: Anaspec Inc

TAMRA-X contains a seven-atom aminohexanoyl spacer (known as ‘X’) between TAMRA fluorophore and the succinimidyl ester. The ‘X’ spacer separates the fluorophore from the biomolecule to which it is conjugated, potentially reducing the quenching that typically occurs upon conjugation. We recommend this TAMRA-X derivative as the preferred dye for preparing TAMRA-labeled proteins when the fluorescence quenching of the labeling dye by protein is a serious problem.

Supplier: Anaspec Inc

This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence:YSMKETTMKIIPFNRLSIG
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
MW: 4504.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2
MW: 1773 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. Native pro-MMP-1 is prepared from culture medium of human rheumatoid synovial fibroblasts. MMP-1 is secreted as pro-enzyme, which consists of a propeptide of 80 amino acids, a catalytic domain of 162 amino acids, a 16-residue linker region, and a hemopexin domain of 189 amino acids. The native pro-MMP-1 has a major Mr 52-kDa unglycosylated and a minor Mr 57-kDa glycosylated form. The proteolytic activation of the 57/52-kDa species will form 47/42-kDa active collagenase, and a 22-kDa C-terminal fragment
The apparent Mr on SDS-PAGE is approximately 56kDa/52 kDa. The pro-MMP-1 can be fully activated by incubating with 1 mM APMA at 37°C for 3 hr. Its activity can be measured by FRET peptides. 10-20 ng of enzyme is sufficient for FRET-based assay

Supplier: Anaspec Inc

This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 181-188, and has been identified as the primary epitope of TRP2 recognized by anti-B16 melanoma cytotoxic T lymphocytes (CTLs).
Sequence:VYDFFVWL
MW:1088.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence:KMMISYTFPIERTGLISNK
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a peptide substrate for polypeptide N-acetylgalactosaminyltransferase (polypeptide GalNAc-T).
Sequence:PTTDSTTPAPTTK
MW:1317.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.

Supplier: Anaspec Inc

This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cell-permeable substrate for fluorimetric detection of oxidases (including peroxidase)

Supplier: Anaspec Inc

Type II casein kinase (CK-2) is unique among the protein kinases since it can use ATP as well as GTP as a phosphoryl donor. It is extremely sensitive to heparin inhibition and can be activated by polyamines and basic polypeptides. This peptide contains the consensus phosphorylation sequence for CK2 and can be used as the substrate for CK2 a-subunit.
Sequence:RRRDDDSDDD
MW:1264.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence:KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2133.5 Da
% peak area by HPLC:95
Storage condition:-20° C