1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This epitope tag is a short hydrophilic, highly charged peptide. It is the most widely used epitope tag employed in structural and functional studies of proteins.
Sequence:DYKDDDDK
MW:1013 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a fluorescent (FITC)-labeled Prototype of RGD-containing peptide, Abs/Em=492/516 nm.
Sequence:FITC-LC-GRGDSP
MW:1091.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

Supplier: Anaspec Inc

This is Oxytocin (OT) N-terminally labeled with Biotin. OT is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1234.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

ß-Secretase (BACE1) is a key enzyme involved in the production of Aß peptides found in extracellular amyloid plaques of Alzheimer’s disease (AD). The enzyme has been implicated as an excellent target for anti-amyloid therapy of AD. This statine-based substrate analog, beta-secretase inhibitor P10–P4’ statV, is used in the inhibition of beta-secretase activity from homogenized wild-type mouse cortices and from BACE-purified from human brain.
Sequence:KTEEISEVN-Sta-VAEF (Sta = statine)
MW:1651.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The NGR (Asn-Gly-Arg) peptide motif is an aminopeptidase N (CD13) ligand that targets angiogenic blood vessels. NGR-containing peptides have been proven useful for delivering cytotoxic drugs, proapoptotic peptides and tumor necrosis factor (TNF) to tumor vasculature.
Sequence:CNGRCG (Disulfide bridge: 1-5)
MW:606.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

M-13 is a peptide that represents CAM-binding domain of Calmodulin (CaM) target proteins. CaM is an ubiquitous Ca2+ binding protein.
Sequence:KRRWKKNFIAVSAANRFKKISSSGAL
MW:2964.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb.
Sequence: SIINFEKL
MW: 963.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

HLA-B*3501 restricted influenza virus nucleoprotein epitope (383-391).
Sequence: SRYWAIRTR
MW: 1208.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is histone H4 (1-23) monomethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me1)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2843.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 2Abz/Dnp FRET pair for quantitation of complement enzyme activity.
Sequence:2Abz-SLGRKIQIK(Dnp)-NH2
MW:1326.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 488 hydroxylamine is a carbonyl-reactive labeling dye, which reacts more readily with aldehydes at physiological pH than other primary amine-containing reagents (such as hydrazides and amines).

Supplier: Anaspec Inc

This peptide is amino acids 17 to 26 fragment of p53, the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence:ETFSDLWKLL
MW:1251.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Caloxin 1b1 is obtained by screening for binding to extracellular domain 1 of PMCA4, which inhibited PMCA extracellularly, selectively, and had a higher affinity for PMCA4 than PMCA1. Because caloxin 1b1 had been selected to bind to an extracellular domain of PMCA, it could be added directly to cells and tissues to examine its effects on smooth muscle and endothelium.
Sequence:TAWSEVLHLLSRGGG
MW:1582.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Group I of this 180 distinct peptide mixtures, in combination with Group II of 18 distinct peptide mixtures (cat# 62335), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of the different kinases. Amount provided is 1 mg of peptide mixture x 180 vials. Sequences: Y-A-Z-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-Z-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-Z-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-Z-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-Z-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-Z-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-Z-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-Z-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-Z-A-G-K-K(LC-Biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. Z = fixed position varied between the 20 natural amino acids.

Supplier: Anaspec Inc

This peptide represents amino acid residues 5-23 of histone H3 and can be used as a substrate for histone acetyl-transferase (HAT) assays.
Sequence:QTARKSTGGKAPRKQLASK
MW:2013.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 21 to 43. It is monomethylated at lysine 23 with a C-terminal G linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:AT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2946.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 (21-44). It is acetylated at lysine 36 with a C-terminal G linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine (K) 36 is highly conserved in mammals and is mainly localized to the promoters of RNA polymerase II-transcribed genes. The transition between the acetylation and methylation of K36 acts as an “acetyl/methyl switch”, controlling chromatin function along transcription units. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPATGGV-K(Ac)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This novel fluorogenic substrate of HDACs was synthesized with an epsilon-acetylated lysyl moiety and an adjacent MCA moiety at the C-terminus of the peptide chain. The assay utilizing this substrate provides a good tool to characterize the HDAC activity. HDACs are important enzymes for the transcriptional regulation of gene expression.
Sequence:Ac-RGK(Ac)-AMC
MW:600.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This renin FRET peptide is a specific substrate for rat renin. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by rat renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. The SensoLyte® 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.
Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
MW: 4109.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a 1 to 20 amino acid fragment of the interphotoreceptor retinoid binding protein (IRBP). IRBP is a 140-kDa glycolipoprotein residing in the interphotoreceptor matrix between the neural retina and the retinal pigment epithelium. Human IRBP peptide 1-20 contains a major epitope for the H-2b haplotype. Immunization with IRBP (1 – 20) induces T-cell–mediated experimental autoimmune uveoretinitis (EAU) disease. The pathology of disease induced by the peptide, or by adoptive transfer of cells specific to the peptide, is similar to that induced by the whole IRBP protein.
Sequence:GPTHLFQPSLVLDMAKVLLD
MW:2194.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL, it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence:STKKLSECLKRIGDELDSNM
MW:2267.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a fragment of the influenza virus matrix protein amino acid residues 62 to 70. It contains the core sequence of a new major histocompatibility complex class II-restricted T-cell epitope of influenza virus matrix protein. This epitope was detected in the peripheral blood of influenza A patients.
Sequence:GFVFTLTVPSER
MW:1352.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Deltorphin A peptide was isolated from skin extracts of the South American frog, Phyllomedusa sauvagei. Deltorphin A is a potent and selective agonist for the delta-opioid receptor.
Sequence:YmFHLMD-NH2
MW:955.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acids 1 to 7 fragment of the histone H4. Alterations in chromatin structure, such as nucleosome sliding, removal of nucleosomes, and disruption of DNA–histone or histone–histone contacts through post-translational modification of the histones, have been linked to transcriptional regulation, DNA damage repair, and replication, among other cellular processes. Modification of histones occurs primarily in the N-terminal residues or tail region. These modifications include phosphorylation, ubiquitinylation, methylation, sumolyation, and acetylation. Lys5 may serve as the acetylation site for this peptide.
Sequence:SGRGKGG
MW:617.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.
Sequence:WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
MW:4248.6 Da
% peak area by HPLC:95
Storage condition:-20° C