Order Entry
Canada
ContactUsLinkComponent
1874 results for "Anaspec Inc"

1874 Results for: "Anaspec Inc"

Sort By

Human;Mouse;Rat Beta-Amyloid (25-35) HCl

Supplier: Anaspec Inc

All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: GSNKGAIIGLM - HCl
Molecular Weight: 1060.3+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

ClearPoint™ Human Ang II Isotope Labeled

Supplier: Anaspec Inc

The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed through cleavage of Ang I by the angiotensin-conve
Sequence: DRVY-I*-HPF [I*= I(U13C6,15N)]
MW: 1053.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Human Beta-Amyloid (1-38)

Supplier: Anaspec Inc

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Moth MCC (88-103)

Supplier: Anaspec Inc

This peptide is derived from the carboxyl terminus of moth MCC (88-103) and pigeon cytochrome c plays a major role in T-cell selection. MCC (88-103) can induce positive selection of TCR transgenic thymocytes
Sequence:ANERADLIAYLKQATK
MW:1805.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

5(6)-TAMRA special formulation

Supplier: Anaspec Inc

5(6)-TAMRA is the mixture of two carboxy tetramethylrhodamine (TMR) isomers. It is used to modify amino and hydroxy groups using EDC-mediated couplings when there are difficulties in using 5(6)-TAMRA, SE. TAMRA is one of the most popular fluorophores used in various bioconjugations.

Expand 3 Items
Loading...

Human Adrenomedullin (1-52)

Supplier: Anaspec Inc

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin),Biotin

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 21 to 44 di-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

Renin 390 FRET Substrate I

Supplier: Anaspec Inc

This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS), acting through type 1 angiotensin (AT1) receptors, is a master regulator of fluid homeostasis.
Sequence:R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
MW:2282.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Oxytocin Peptide

Supplier: Anaspec Inc

Oxytocin (OT) is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1007.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

SensoLyte® Homogeneous AFC Caspase-3/7 Assay Kit, AnaSpec Inc.

Supplier: Anaspec Inc

Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7

Expand 1 Items
Loading...

Human Cys-beta-Amyloid (1-40)

Supplier: Anaspec Inc

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

SensoLyte® AFC Plasmin Activity Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

Plasmin belongs to the family of serine proteases

Expand 1 Items
Loading...

Magainin 2

Supplier: Anaspec Inc

Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

[Lys(Ac) 5/8/12/16]-Histone H4 (1-25)-GSGSK,Biotin

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys5, Lys8, Lys12, and Lys16, followed by a C-terminal GSGS linker and a biotinylated lysine. Acetylation at Lys5, Lys8, and Lys12 is carried out by p300 protein while acetylation at Lys16 is regulated by several histone acetyltransferases. These lysine residues have been shown to have important functions in transcriptional activation, replication, and nuclear division. Acetylation of lysine residues promotes binding of transcription factors to histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3400.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Thrombin Receptor Agonist

Supplier: Anaspec Inc

A protease-activated receptor (PAR-1) agonist peptide (P5-NH2) identified as the minimal structural motif required for retaining the full agonist activity.
Sequence:SFLLR - NH2
MW:634.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

[Lys(Me3)4]-Histone H3 (1-10)

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4.
Sequence:ART-K(Me3)-QTARKS
MW:1188.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Toad Bombesin

Supplier: Anaspec Inc

Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

[Lys(Me3)9]-Histone H3 (3-17)

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-9.
Sequence:TKQTAR-K(Me3)-STGGKAPR
MW:1628.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® Anti-Mouse MOG (1-125) IgG Quantitative ELISA Kit, AnaSpec

Supplier: Anaspec Inc

This kit is optimized to detect anti-mouse MOG (1-125) IgG. Wells are pre-coated with recombinant mouse MOG (1-125) protein and pre-blocked with BSA. The amount of anti-mouse MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.

Expand 1 Items
Loading...

PKC (Protein Kinase C) Substrate

Supplier: Anaspec Inc

The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human [Thr28, Nle31]-Cholecystokinin (25-33), sulfated

Supplier: Anaspec Inc

Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.
Sequence: RD-Y(SO3H)-TGW-Nle-DF-NH2
MW: 1251.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

NBD-X ≥95% (by HPLC)

Supplier: Anaspec Inc

NBD-X, Synonym: 6-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoic acid, building block that can be used to prepare peptide conjugates and other bioconjugate, Molecular Weight: 294.27, Spectral Properties: Abs/Em = 467/539 nm, Solvent System: DMSO, Size: 100mg

Expand 1 Items
Loading...

[Glu3]-RGES, Control for RGD Peptides

Supplier: Anaspec Inc

This peptide is a control for the RGDS Fibronectin Active Fragment and other RGD-related peptides. Asp3 is replaced by Glu3 in RGDS peptide changing its properties to inhibit integrins and proteins of extracellular matrix binding.
Sequence:RGES
MW:447.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Congo red, Ultra Pure Grade

Supplier: Anaspec Inc

Congo Red, UltraPure Grade, Early diagnosis and classification of amyloid deposition, Molecular Weight: 696.7, Spectral Properties: Abs/Em = 497/NA nm, Solvent System: Water, CAS number: 573-58-0, Molecular formula: C32H22N6Na2O6S2, Physical State: Solid, Storage: -20 deg C, Size: 1 g

Expand 1 Items
Loading...

[Lys(Ac)56]-Histone H3 (44-63)

Supplier: Anaspec Inc

This peptide is histone H3 (44-63) with acetylation at Lys56. Lys56 acetylation occurs during premeiotic and mitotic S phases and persists through DNA damage repair and is catalyzed by the Rtt109-Vps75 histone acetyltransferase (HAT) complex. A deficiency of acetylated Lys56 in histone H3 is implicated in spontaneous chromosome breaks during mitosis, suggesting that this modification is important for replisome integrity and DNA replication.
Sequence:GTVALREIRRYQ-K(Ac)-STELLIR
MW:2444.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

AnaTag™ 5 - TAMRA Protein Labeling Kit *Ultra Convenient*, Anaspec

Supplier: Anaspec Inc

TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Expand 1 Items
Loading...

SensoLyte® 520 Cathepsin K Assay Kit Fluorimetric, AnaSpec, Inc.

Supplier: Anaspec Inc

Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption, also having a potential as a drug target in autoimmune diseases and osteoporosis

Expand 1 Items
Loading...

Interphotoreceptor Retinoid Binding Protein Fragment Peptide

Supplier: Anaspec Inc

R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Amyloid-Forming Peptide GNNQQNY

Supplier: Anaspec Inc

This is a heptapeptide from the N-terminal prion-determining domain of the yeast protein Sup35 that forms amyloid fibrils. The availability of its detailed atomic oligomeric structure makes it a good model for studying the early stage of aggregation. The GNNQQNY dimer forms three stable sheet structures. in-register parallel, off-register parallel, and anti-parallel. The in-register parallel dimer, which is close to the amyloid beta-sheet structure, has few interpeptide hydrogen bonds, making hydrophobic interactions more important and increasing the conformational entropy compared to the anti-parallel sheet.
Sequence: GNNQQNY
Molecular Weight: 836.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

epsilon-V1-2

Supplier: Anaspec Inc

This peptide is derived from residues 14-21 of protein kinase C C2 (εPKC C2). This peptide specifically inhibits εPKC by disrupting PKC binding to its receptor, RACK2. εPKC mediated signal transduction plays a role in cell proliferation, differentiation, and apoptosis.
Sequence:EAVSLKPT
MW:844 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
Sort By
Recommended for You