1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This is a Histone 3 peptide trimethylated at lysine 36. It's role has been indicative of defining exons, as certain nucleosome-enriched exons are observed to be enriched in some histone modifications. It is belived that this pattern of modification as seen with this H3K36me3 peptide, influences alternative splicing, perhaps by signaling effector proteins to mark particular exons for inclusion in the final transcript as they exit the RNA Polymerase II complex. It has also been shown in yeast that H3K36me3 gets deposited on histones as they are displaced by RNA polymerase II (RNAPII) during transcription. H3K36me3 then serves as a mark for HDACs to bind and deacetylate the histones.
Sequence:ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

[Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a biotinylated CGRP with a long chain linker attached at the N-terminus end.
Sequence:Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:4128.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

HiLyte™ Fluor 405 is a blue fluorescent dye with Ex/Em = 404/428 nm, spectrally similar to Alexa Fluor™ 405 and DyLight Fluor™ 405 dyes.

Supplier: Anaspec Inc

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a monomethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. It’s chromatin mark was also closely correlated to cell-type specific expression of putative gene targets of enhancers. It was also noted from a genome wide study that most potential regulatory elements were enriched only by the mono-methylated version of this histone 3.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA
MW:2268.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is beta-amyloid (10-35) with a Lys added on the C-terminus, biotin is attached to the side chain of this Lys.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
Molecular Weight: 3256.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Dansyl-X, SE, Synonym: Dansyl-X, NHS ester, amino-reactive building block used to prepare peptide conjugates and other bioconjugates, high efficient, Molecular Weight: 461.53, Spectral Properties: Abs/Em = 333/518 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 25 mg

Supplier: Anaspec Inc

Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 27-residue peptide is derived from subdomain 1B of the repetitive domains of calpain, named peptide B27-WT. It is a potent inhibitor of calpain.
Sequence:DPMSSTYIEELGKREVTIPPKYRELLA
MW:3136.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycemia.
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3482.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em = 551/567 nm.

Supplier: Anaspec Inc

This is a myristoylated form of Autocamtide-2-Related Inhibitory Peptide (AIP), a highly potent and specific substrate competitive inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII). AIP is derived from Autocamtide-2, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALRRQEAVDAL
MW:1708.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

GST (Glutathione S-Transferase) enzymes, a family of isozymes plays a crucial role in body defense mechanisms against toxins and carcinogens

Supplier: Anaspec Inc

Although DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates, its extremely high hydrophobicity and resultant poor water solubility have limited its use in the development of sensitive fluorogenic FRET probes. DABCYL Plus™ is developed to address this limitation. DABCYL Plus™ retains spectral properties similar to those of DABCYL. This feature enables researchers to keep all assay settings similar to those of DABCYL’s probes. In addition, DABCYL Plus™ has much greater water solubility than DABCYL. We have used DABCYL Plus™ to develop various protease substrates. In some cases, it has demonstrated greatly improved enzyme performance.

Supplier: Anaspec Inc

This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavag

Supplier: Anaspec Inc

This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation.
Sequence: trans - Cinnamoyl - YPGKF - NH2
MW: 739.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is HiLyte Fluor 647 labeled Exendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 5486.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

BACE2 (β-Secretase-2, Memapsin-1) belongs to the family of transmembrane aspartic proteases

Supplier: Anaspec Inc

This peptide is derived from fibrinopeptide B amino acid residues 1-14. It is used as a mass spec (MS) standard in proteomic research.
Sequence:EGVNDNEEGFFSAR
MW:1570.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV) pre-glycoprotein polyprotein GP complex. LCMV has been routinely used for the study of adaptive immune responses to viral infection.
Sequence:GLNGPDIYKGVYQFKSVEFD
MW:2276.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This fluorogenic HIV-1 protease substrate contains the FRET pair HiLyte488 (fluorophore) and QXL520 (quencher), and a γ-Abu spacer. This FRET substrate is cleaved by the HIV-1 protease to generate fuorescence (Ex = 490nm; Em = 520nm).
Sequence:QXL™520-GABA-SQNYPIVQ-K(HiLyte Fluor™ 488)-NH2
MW:2008.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 acetylated at lysine 14. Histone lysine aetylation is known to play an important role in chromatin-directed gene transcription. A bromodomain 2 of polybromo (a chromatin remodelling protein) preferentially recognizes acetylated lysine of H3.
Sequence:ARTKQTARKSTGG-K(Ac)-APRKQ
MW:2112.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

DABCYL acid is the abbreviation of 4-(dimethylaminoazo)benzene-4-carboxylic acid. In some literature, DABSYL (4-dimethylaminoazobenzene-4'-sulfonyl chloride) is misused as ‘DABCYL’. DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL dyes are often paired with EDANS in FRET-based fluorescent probes.

Supplier: Anaspec Inc

This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptors and is known to mediate the cellular effects of thrombin. In addition to it's varied cellular effects of thrombin, PAR-1 also has been shown to co-ordinate with PAR-4 and regulate thrombin-induced hepatocellular carcinoma harboring thrombin formation within the tumor environment classified as 'coagulation type'.
Sequence: TFLLRN-NH2
MW: 761.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption. It has potential as a drug target in autoimmune diseases and osteoporosis.
This FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids and cell lysates. Abz-HPGGPQ-EDDnp [where Abz represents o-aminobenzoic acid and EDDnp represents N -(2,4-dinitrophenyl)-ethylenediamine], a substrate initially developed for trypanosomal enzymes, is efficiently cleaved at the Gly-Gly bond by cathepsin K. This peptide is resistant to hydrolysis by cathepsins B, F, H, L, S and V, Ex/Em=340 nm/420 nm.
Sequence:Abz-HPGGPQ-EDDnp
MW:920 Da
% peak area by HPLC:95
Storage condition:-20° C