1874 Results for: "Anaspec Inc"
SensoLyte® Rh110 Matriptase Activity Assay Kit (Fluorimetric), AnaSpec Inc.
Supplier: Anaspec Inc
Matriptase (also known as MT-SP1, ST14, TADG-15 and epithin) is a trypsin-like protease from the family of type II transmembrane serine proteases
Expand 1 Items
SensoLyte® Anti-MOG(35-55) IgG Quantitative ELISA Kit (Mouse/Rat), AnaSpec
Supplier: Anaspec Inc
MOG peptide fragment (35-55) induces autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination
Expand 1 Items
5(6)-TAMRA-X, SE
Supplier: Anaspec Inc
TAMRA-X contains a seven-atom aminohexanoyl spacer (known as ‘X’) between TAMRA fluorophore and the succinimidyl ester. The ‘X’ spacer separates the fluorophore from the biomolecule to which it is conjugated, potentially reducing the quenching that typically occurs upon conjugation. We recommend this TAMRA-X derivative as the preferred dye for preparing TAMRA-labeled proteins when the fluorescence quenching of the labeling dye by protein is a serious problem.
Expand 1 Items
Gamma-Fibrinogen (377-395) Peptide
Supplier: Anaspec Inc
This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence:YSMKETTMKIIPFNRLSIG
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human [Gln22, Asn23]-beta-Amyloid (1-40)
Supplier: Anaspec Inc
This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
TIP 39, Tuberoinfundibular Neuropeptide
Supplier: Anaspec Inc
This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
MW: 4504.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Chicken OVA (323-339)
Supplier: Anaspec Inc
This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2
MW: 1773 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Expand 1 Items
Human MMP-1 (from E. coli)
Supplier: Anaspec Inc
Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. Native pro-MMP-1 is prepared from culture medium of human rheumatoid synovial fibroblasts. MMP-1 is secreted as pro-enzyme, which consists of a propeptide of 80 amino acids, a catalytic domain of 162 amino acids, a 16-residue linker region, and a hemopexin domain of 189 amino acids. The native pro-MMP-1 has a major Mr 52-kDa unglycosylated and a minor Mr 57-kDa glycosylated form. The proteolytic activation of the 57/52-kDa species will form 47/42-kDa active collagenase, and a 22-kDa C-terminal fragment
The apparent Mr on SDS-PAGE is approximately 56kDa/52 kDa. The pro-MMP-1 can be fully activated by incubating with 1 mM APMA at 37°C for 3 hr. Its activity can be measured by FRET peptides. 10-20 ng of enzyme is sufficient for FRET-based assay
Expand 1 Items
Tyrosinase-Related Protein 2 (181-188)
Supplier: Anaspec Inc
This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 181-188, and has been identified as the primary epitope of TRP2 recognized by anti-B16 melanoma cytotoxic T lymphocytes (CTLs).
Sequence:VYDFFVWL
MW:1088.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Gamma-Fibrinogen (377-395)
Supplier: Anaspec Inc
This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence:KMMISYTFPIERTGLISNK
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human;Sheep;Rat PACAP (6-38), amide
Supplier: Anaspec Inc
This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Human Recombinant MMP-12 (from E. coli)
Supplier: Anaspec Inc
Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-12 (macrophage elastase) is involved in smoke-induced emphysema, tumor and other diseases. MMP-12 is secreted as a 54-kDa zymogen and becomes the mature 45-kDa active form after proteolytic cleavage. MMP-12 has a broad range of substrates, including α-1 proteinase inhibitor, α-2 antiplasmin, plasminogen activator inhibitor-2, collagen IV, laminin, fibronectin, elastin, but not interstitial collagens.
The sequence (Accession # NP_002417) corresponding to the catalytic domain (aa 106-267) of Human MMP-12 was expressed in E. coli. The recombinant human MMP-12 was purified from bacterial lysate and refolded using proprietary technique. The molecular weight of the recombinant Human MMP-12 Catalytic Domain is 18 kDa.
Expand 3 Items
Mucin 10 (153-165)
Supplier: Anaspec Inc
This is a peptide substrate for polypeptide N-acetylgalactosaminyltransferase (polypeptide GalNAc-T).
Sequence:PTTDSTTPAPTTK
MW:1317.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Bovine Indolicidin
Supplier: Anaspec Inc
Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Peptide YY (3-36)
Supplier: Anaspec Inc
This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Human [Gla17,21,24]-Osteocalcin (1-49) Peptide
Supplier: Anaspec Inc
Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 3 Items
Human;Mouse;Rat Beta-Amyloid (25-35)
Supplier: Anaspec Inc
Aß (25-35) is the main factor responsible for Aß neurotoxic effects.
Expand 2 Items
HiLyte™ Fluor 555 acid, SE fluorescent dye
Supplier: Anaspec Inc
HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.
Expand 1 Items
HIV TAT (47-57) Peptide
Supplier: Anaspec Inc
This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Expand 2 Items
(Arg)9, FAM (Carboxyfluorescein), AnaSpec
Supplier: Anaspec Inc
(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
2',7'-Dichlorofluorescein 3',6'-diacetate
Supplier: Anaspec Inc
Cell-permeable substrate for fluorimetric detection of oxidases (including peroxidase)
Expand 1 Items
Casein Kinase 2 (CK2) Substrate alpha
Supplier: Anaspec Inc
Type II casein kinase (CK-2) is unique among the protein kinases since it can use ATP as well as GTP as a phosphoryl donor. It is extremely sensitive to heparin inhibition and can be activated by polyamines and basic polypeptides. This peptide contains the consensus phosphorylation sequence for CK2 and can be used as the substrate for CK2 a-subunit.
Sequence:RRRDDDSDDD
MW:1264.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
TP53 Q9NP68
Supplier: Anaspec Inc
This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence:KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2133.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
LKBtide Peptide
Supplier: Anaspec Inc
This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.
Sequence:LSNLYHQGKFLQTFCGSPLYRRR
MW:2785.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
490 MMP FRET Substrate III, DABCYL-EDANS
Supplier: Anaspec Inc
Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide has an optimized sequence for MMP-7, with the cleavage occuring at the Ala-Leu bond. The substrate is used for high throughput screening of MMP-7 inhibitors. Abs/Em = 340/490 nm.
Sequence:DABCYL-RPLALWRS-EDANS
MW:1497.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human;Mouse;Rat Beta-Amyloid (16-22)
Supplier: Anaspec Inc
This is a short fragment of the b-Amyloid peptide containing two aromatic phenylalanine residues. Short peptide models have provided novel insight into the mechanistic issues of amyloid formation. This heptapeptide fragment has the capacity of forming typical amyloid fibrils in vitro. Aromatic interactions are important in many cases of amyloid formation.
Sequence: KLVFFAE
Molecular Weight: 853 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Expand 1 Items
Human Big Endothelin-1 (1-38)
Supplier: Anaspec Inc
Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
MW:4283 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
QXL® 490 acid, SE fluorescent dye
Supplier: Anaspec Inc
QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.
Expand 1 Items
BDC2.5 Mimotope
Supplier: Anaspec Inc
The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet beta cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.
Sequence: RTRPLWVRME
MW: 1343.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
SensoLyte® Anti-Rat MOG (1-125) IgG Quantitative ELISA Kit, AnaSpec
Supplier: Anaspec Inc
This kit is optimized to detect anti-rat MOG (1-125) IgG. Wells are pre-coated with recombinant rat MOG (1-125) protein and pre-blocked with BSA. The amount of anti-rat MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.