1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4983.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Des-octanoyl (or Des-acyl) Ghrelin is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPR
MW: 3188.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:Biotin-YGGFLRRIRPKLKWDNQ
MW:2373.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is histone H3 (1-21) dimethylated at Lys9. Methylation of Lys 9 is associated with transcriptionally silent chromatin. Histone H3 mono- and dimethylated at Lys 9 localize specifically to silent domains within euchromatin while histone H3 trimethylated at this residue localizes to pericentric heterochromatin.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:C(Npys)rrrrrrrrr-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This synthetic peptide is a biotinylated substrate for Syk kinase.
Sequence:Biotin-KEDPDYEWPSAK-NH2
MW:1689.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acids 25 to 35 fragment of beta-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm.
Sequence: HiLyte™ Fluor 488-GSNKGAIIGLM
Molecular Weight: 1416.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Calcein, AM is a cell-permeant and non-fluorescent compound that is widely used for determining cell viability

Supplier: Anaspec Inc

This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is amino acids 22 to 41 fragment of beta-amyloid peptide, biotinylated through an LC spacer at the N-terminus.
Sequence: Biotin-LC-EDVGSNKGAIIGLMVGGVVI
Molecular Weight: 2267.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Removal of any preexisting structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupt hydrophobic forces in aggregated amyloid preparations, and promotes α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide resulted in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films.

Supplier: Anaspec Inc

A highly sensitive FRET substrate for assaying HCV (Hepatitis C Virus) NS3/4A protease activity. It detects < 0.1pmol of HCV NS3/4A protease. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 490/512 nm.
Sequence:Ac-DE-Dap(QXL520)-EE-Abu-ψ;-[COO]AS-C(5-FAMsp)-NH2
MW:1913.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The SensoLyte® ThT β-Amyloid (1-40) Aggregation kit provides a convenient and standard method to measure Aβ40 aggregation using Thioflavin T dye

Supplier: Anaspec Inc

This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.

Supplier: Anaspec Inc

This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide sequence is derived from the Gag spacer peptide p1 that is encoded in the frameshift region of human immunodeficiency virus type 1 (HIV-1).
Sequence:HHHHHHIIKIIK
MW:1549.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

A potent inhibitor specific for ACE2. It has a Ki of 2.8 nM.
Sequence:Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
MW:3076.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

HLA A2.1-restricted epitope from Epstein-Barr Virus latent membrane protein LMP2 (426-434).
Sequence: CLGGLLTMV
MW: 906.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C