1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation.
Sequence: trans - Cinnamoyl - YPGKF - NH2
MW: 739.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is HiLyte Fluor 647 labeled Exendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 5486.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

BACE2 (β-Secretase-2, Memapsin-1) belongs to the family of transmembrane aspartic proteases

Supplier: Anaspec Inc

This peptide is derived from fibrinopeptide B amino acid residues 1-14. It is used as a mass spec (MS) standard in proteomic research.
Sequence:EGVNDNEEGFFSAR
MW:1570.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV) pre-glycoprotein polyprotein GP complex. LCMV has been routinely used for the study of adaptive immune responses to viral infection.
Sequence:GLNGPDIYKGVYQFKSVEFD
MW:2276.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This fluorogenic HIV-1 protease substrate contains the FRET pair HiLyte488 (fluorophore) and QXL520 (quencher), and a γ-Abu spacer. This FRET substrate is cleaved by the HIV-1 protease to generate fuorescence (Ex = 490nm; Em = 520nm).
Sequence:QXL™520-GABA-SQNYPIVQ-K(HiLyte Fluor™ 488)-NH2
MW:2008.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 acetylated at lysine 14. Histone lysine aetylation is known to play an important role in chromatin-directed gene transcription. A bromodomain 2 of polybromo (a chromatin remodelling protein) preferentially recognizes acetylated lysine of H3.
Sequence:ARTKQTARKSTGG-K(Ac)-APRKQ
MW:2112.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

DABCYL acid is the abbreviation of 4-(dimethylaminoazo)benzene-4-carboxylic acid. In some literature, DABSYL (4-dimethylaminoazobenzene-4'-sulfonyl chloride) is misused as ‘DABCYL’. DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL dyes are often paired with EDANS in FRET-based fluorescent probes.

Supplier: Anaspec Inc

This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptors and is known to mediate the cellular effects of thrombin. In addition to it's varied cellular effects of thrombin, PAR-1 also has been shown to co-ordinate with PAR-4 and regulate thrombin-induced hepatocellular carcinoma harboring thrombin formation within the tumor environment classified as 'coagulation type'.
Sequence: TFLLRN-NH2
MW: 761.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption. It has potential as a drug target in autoimmune diseases and osteoporosis.
This FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids and cell lysates. Abz-HPGGPQ-EDDnp [where Abz represents o-aminobenzoic acid and EDDnp represents N -(2,4-dinitrophenyl)-ethylenediamine], a substrate initially developed for trypanosomal enzymes, is efficiently cleaved at the Gly-Gly bond by cathepsin K. This peptide is resistant to hydrolysis by cathepsins B, F, H, L, S and V, Ex/Em=340 nm/420 nm.
Sequence:Abz-HPGGPQ-EDDnp
MW:920 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Chromogenic N-acetylgalactosaminidase substrate

Supplier: Anaspec Inc

This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Cathepsin B is a member of the cathepsin family consisting of 12 cysteine proteases with broad exo- and endopeptidase activity

Supplier: Anaspec Inc

This Histone 4 peptide is acetylated at lysine 16. Lysine 16 of H4 appears to be a unique target for acetylation. Studies in yeast clearly indicate that acetylation of H4 lysine 16 is an independent specific function in relation to gene transcription when compared to other histone acetylation sites. It was also observed that a human histone acetyltransferase complex showed strong specificity for H4K16 in chromatin and, RNAi-mediated knockdown experiments revealed that it is responsible for the majority of H4 acetylation at lysine 16 in the cell.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cleavage of this FRET substrate generates the fluorescent Mca signal that is monitored fluorimetrically at 393 nm, with excitation at 325 nm. A highly fluorescent substrate for caspase 1.
Sequence: Mca-YVADAPK(Dnp)
MW: 1145.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide, with the diaminopimelic acid coupled to the gamma-carboxylic acid of the D-isomer of Glu, stimulates Nod1-dependent apoptosis.
Sequence:A-(g-e)-DAP
MW:390.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy™ 3 dyes, resulting in an optimal match to filters designed for CyTM dyes.

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys5. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys5 plays a role in histone deposition and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This RGD-containing sequence is integrin-binding site. RGD peptides are found in both extracellular matrix (ECM) (e.g., collagen, osteopontin, fibronectin, and vitronectin) and non-ECM proteins (e.g., disintegrins). RGD-containing peptides are recognized by several integrins. This peptide targets both alphavbeta3 and alpha5beta1 integrins. Interaction of the RGDN sequence with endothelial alpha5beta1 integrin causes endothelin-mediated arteriolar vasoconstriction. This peptide influences the IkappaB kinase (IKK)/nuclear factor-kappaB (NF-kappaB) activation. It also controls the cardiac contractile function.
Sequence:GRGDNP
MW:614.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
MW:1913.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-8 (neutrophil collagenase) is synthesized by neutrophils and stored in the specific granules until it is secreted.

Human MMP-8 is a full length pro-enzyme isolated from stimulated human neutrophil granulocytes. Proenzyme can be activated by incubating with 1 mM APMA at 37°C for 1 hr. Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.

Supplier: Anaspec Inc

Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Penetratin-Arg is the same as Penetratin except that Lysine residues were substituted with Arginines. It forms an alpha-helix structure in lipid environment and can permeate cell membrane at low micromolar concentration without significantly affecting membrane. CPP can be conjugated with large molecules and used as a drug delivery vehicle. R
Sequence:RQIRIWFQNRRMRWRR
MW:2358.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast, prostate, lung, and melanoma) and by male germline cells, but not by other normal tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4 molecules, including HLA-DRB1*0101, 0401, 0701, and 1101 and HLA-DPB1*0401 and 0402 molecules.
Sequence:LLEFYLAMPFATPMEAELARRSLAQ
MW:2869.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C