1206 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Protection activity of humanin (HN) against neuronal cell death is abrogated in this peptide, where Cys8 is substituted by Ala.
Sequence:MAPRGFSALLLLTSEIDLPVKRRA
MW:2655.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The native peptide, HATPPKKKRK (cat# 60522-1), is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1). The fluorescent and biotinylated peptides are used to develop assays for CDK1.
Sequence:HATPPKKKRK
MW:1190.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration.

Supplier: Anaspec Inc

Cell-permeant DNA minor groove binding dye

Supplier: Anaspec Inc

Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 C2 maleimide is the longest-wavelength thiol-reactive HiLyte™ Fluor dye currently available.

Supplier: Anaspec Inc

This GRG containing peptide is amino acids 1 to 20 fragment of histone 4. It is a substrate for human protein-arginine methyltransferase 7 (PRMT7), a type II methyltransferase capable of producing symmetrical dimethyl arginine (sDMA) modifications in proteins.
Sequence:SGRGKGGKGLGKGGAKRHRK-NH2
MW:1991.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)
MW:3024.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36.
Sequence:STGGV-K(Me1)-KPHRY
MW:1243.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Supplier: Anaspec Inc

This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR) is biotinylated on the N-terminus.
Sequence:Biotin-GEEPLYWSFPAKKK-NH2
MW:1905.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a 5-FAM-labeled cylic RGDyK peptide. RGD peptides serve as ligands for av-integrin and inhibit angiogenesis, induce endothelial apoptosis, decrease tumor growth, and reduce spread of metastasis.
Sequence:Cyclo[-RGDy-K(5-FAM)]
MW:978 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:5-FAM-RQIKIWFQNRRMKWKK-NH2
MW:2604.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

[125I]-(Pyr1)Apelin-13 binds with high affinity and selectivity to human cardiac tissue.
Sequence:Pyr-RPRLSHKGPMPF-OH
MW:1533.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Supplier: Anaspec Inc

This hypothalamic neuropeptide has been shown to regulate feeding behavior.
Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
MW:3561.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Full-length Recombinant human alpha-synuclein (GenBank Accession # NP_000336) was expressed in E. coli., and purified from bacterial lysate using proprietary method. Endotoxin was further removed by proprietary technique.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.

Supplier: Anaspec Inc

The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag at N-terminal was expressed in E. coli. The recombinant GST-Tau-441 protein was purified from bacterial lysate using proprietary method.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Supplier: Anaspec Inc

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This fluorogenic HIV-1 protease substrate contains the FRET pair HiLyte488 (fluorophore) and QXL520 (quencher), and a γ-Abu spacer. This FRET substrate is cleaved by the HIV-1 protease to generate fuorescence (Ex = 490nm; Em = 520nm).
Sequence:QXL™520-GABA-SQNYPIVQ-K(HiLyte Fluor™ 488)-NH2
MW:2008.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The synthetic peptide has been identified as a Src optimal peptide substrate. It may be used to measure the wild type Src activity in comparison with other family members.
Sequence:AEEEIYGEFEAKKKK
MW:1799 Da
% peak area by HPLC:95
Storage condition:-20° C