1874 Results for: "Anaspec Inc"

Supplier: Anaspec Inc

This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys12 and Lys16 and trimethylation at Lys20, followed by a C-terminal GSGS linker and a biotinylated Lys. Trimethylation at Lys20 of histone H4 is catalyzed by Suv4-20 and is involved in transcriptional silencing and heterochromatin formation in eukaryotes. It has been shown that histone H4 is preferentially acetylated first at Lys16, then at Lys12. Diacetylated histone H4 has been shown to bind repressor protein TUP1. Acetylation of histone H4 also regulates heterochromatin formation by promoting the binding of bromodomains to p300 and transcription factor TAFII250 and inhibiting interactions with SIR3. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDN-GSGSK(Biotin)
MW:3358.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cell-permeant DNA minor groove binding dye

Supplier: Anaspec Inc

This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.
Sequence:MASGVMVSDDVVKVFN
MW:1698 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.
Sequence:YKEGYNVYG
MW:1092.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is an amidated peptide derived from residues 361-393 of human p53 tumor suppressor protein with acetylation at Lys382. This peptide is biotin-labeled at its N-terminus with a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-GSRAHSSHLKSKKGQSTSRHK-K(Ac)-LMFKTEGPDSD-NH2
MW:4034.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 750 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Supplier: Anaspec Inc

This b-amyloid (1-42) contains the Flemish (D23N) mutation where Asp23 is replaced by Asn.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

β-galactosidase, encoded by the lacZ gene in E. coli, is widely used as a reporter enzyme to study gene expression, protein-protein interaction and normalization of transfection efficiency in mammalian cells.

Supplier: Anaspec Inc

This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.
Sequence:RRRRRRRRGEDIIRNIARHLAQVGDSMDR
MW:3616.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the site of reaction is at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions. Fluorescein-5-maleimide is one of the most popular fluorescent dyes for thiol modifications of proteins.

Supplier: Anaspec Inc

This amino acids 11 to 22 fragment of b-amyloid is capable of forming well-organized amyloid fibrils in vitro, similar to the pathogenic ones found in amyloidosis. Analysis of the structural properties of one monomer of b-amyloid (11-22) as well as of the aggregation mechanisms for four chains of b-amyloid (11-22) showed that the system assembles rapidly into a random globular state that evolves into three- and four-stranded antiparallel beta-sheets. The aggregation process is considerably accelerated by the presence of preformed dimers.
Sequence: EVHHQKLVFFAEDVG
Molecular Weight: 1755 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

7-Hydroxycoumarin-3-carboxylic acid is one of the most popular blue fluorophores for labeling proteins and nucleic acids mostly through the in situ formation of its succinimidyl ester (81206). This coumarin is also increasingly used to label peptides, nucleotides and carbohydrates.

Supplier: Anaspec Inc

Long wavelength fluorescent indicator for quantifying intracellular Ca2+ concentration

Supplier: Anaspec Inc

Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin, also known as acyl-Ghrelin (AG), is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3370.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

DABCYL Plus™ C2 maleimide is an excellent thiol-reactive building block for developing DABCYL Plus™-based FRET probes.

Supplier: Anaspec Inc

This is amino acids 10 to 26 fragment of beta-Amyloid peptide. It is capable of forming fibrils.
Sequence: YEVHHQKLVFFAEDVGS
Molecular Weight: 2005.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

A linear integrin binding peptide. It inhibits endothelial cell adhesion to fibroblast growth factor-2 and to fibronectin.
Sequence:GRGDSPK
MW:715.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is hydrolyzed rapidly by MMP-13, but slowly by MMP-1, 2, 3, 8, 9 and 12, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGLWArK(5-FAM)-NH2
MW:1789.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is histone H3 amino acid residues 1 to 21. It is phosphorylated at Thr-11 with a C-terminal GG linker, followed by a biotinylated lysine. The modification of Thr-11 via phosphorylation is processed by a number of enzymes, including protein kinase C-related kinase 1 (PRK1) and Serine/threonine-protein kinase Chk1. This has many important functions, such as the establishment of a novel chromatin marker for transcriptional regulation, and the regulation of DNA-damage induced transcriptional repression. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKS-pT-GGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:5-TMR-KVEKIGEGTYGVVYK
MW:2082.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases

Supplier: Anaspec Inc

HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys12. It is biotinylated through a C-terminal GSGSK linker. Lys12 acetylation is necessary for the methylation of Lys9 of histone H3 in the formation of heterochromatin. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C