Supplier: Anaspec Inc

26Rfa is a neuropeptide belonging to the RFamide peptide family. It exhibits orexigenic activity and has been associated to obesity. The primary structures of human, rat, and frog 26RFa exhibit 80% identity, and the C-terminal octapeptide is fully conserved from amphibians to mammals.
Sequence:TSGPLGNLAEELNGYSRKKGGFSFRF-NH2
MW:2832.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a biotinylated lysine. This peptide was used to investigate the characteristics and mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes. Immunocytochemical and immunoblot analyses revealed that ethanol treatment significantly increased H3 acetylation at Lys9 with negligible effects at Lys14, 18, and 23.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2723.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is the pro-apoptotic peptide composed of D-amino acids, 5-FAM labeled. This alpha-helical amphipathic peptide is toxic to eukaryotic cells if internalized by a suitable targeting mechanism. It disrupts mitochondrial membranes upon receptor-mediated cell internalization and causes programmed cell death.
Sequence:5-FAM-klaklakklaklak-NH2
MW:1881.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

These 5 Cytomegalovirus (CMV) peptides, at 0.25 mg each (total of 1.25 mg/vial), constitute part of the CEF control peptide pool (cat# AS-61036-025). Now available separately as CMV control peptide pool, Influenza control peptide pool (cat# AS-62340) and EBV control peptide pool (cat# AS-62341), these peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays. All peptides are provided as net weight based on peptide content.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is an integrin-binding peptide.
Sequence:GRGDTP
MW:601.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Somatostatin [SST, GHIH (growth hormone-inhibiting hormone) or SRIF (somatotropin release-inhibiting factor)] is a cyclic peptide hormone existing as two isoforms and produced in the pancreas islet, GI tract and the central nervous system. Tetradecapeptide Somatostatin-14 (SRIF-14, the originally identified somatostatin) and the 28-amino acid Somatostatin-28 (SRIF-28) have similar biological activities but differ in their potency. Somatostatins regulate the endocrine system: they inhibit the release of growth hormone in contrast to Growth Hormone Factor (GRF), which stimulates the release of growth hormone. They also inhibit the release of prolactin and thyrotropin, peptide hormones from the pituitary gland and glucagon and insulin from the pancreas. They control the secretion of gut hormones and function as neurotransmitters.
Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
MW: 3148.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA leads to the increased striatal and pallidal GABA release, and this effect is antagonized by intrastriatal perfusion with the NT receptor antagonist. Neurotensin(8-13) is as potent as neurotensin but ineffective in [D-Tyr(11)]neurotensin. In the caudal nucleus accumbens, neurotensin(8-13) and neurotensin appears more potent than [D-Tyr(11)]neurotensin. In contrast, in the rostral nucleus accumbens, neurotensin(8-13) is less potent than [D-Tyr(11)]neurotensin and neurotensin.
Sequence:RRPYIL
MW:817 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

4N1K is a cell-binding domain adhesive peptide. It has been identified as an IAP agonist. Integrin-associated protein (IAP) is important in host defense where it is required for integrin-dependent functions of polymorphonuclear leukocytes. IAP also appears to be important in modulating integrin function in other cells and in signal transduction upon ligand binding by certain integrins with which it associates.
Sequence:KRFYVVMWKK
MW:1384.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This rat C-peptide-2 differs from the active human C-peptide by several amino acids, however conserved Glu at positions 3, 11, and 27 is essential for peptide activity. In rat medullary thick ascending limb, C-peptide stimulates Na+,K+-ATPase activity within a physiological concentration range. This effect is due to an increase in Na+,K+-ATPase turnover rate that is most likely mediated by protein kinase C-f phosphorylation of the Na+,K+-ATPase f-subunit.
Sequence: EVEDPQVAQLELGGGPGAGDLQTLALEVARQ
MW: 3161.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.

Supplier: Anaspec Inc

This peptide is Histone 4 acetylated at lysine 12. Based on genome-wide localization studies, this peptide has been found to occupy promoter region at the transcription start sites, especially being associated with particular promoters that may drive high levels of mRNA transcripts stored in mature spermatozoa. Such observations have led to assumptions that H4K12Ac may be one of the epigenetic marks for developmentally important genes.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a fusion of A208, derived from murine laminin a1, and the active site of fibronectin (GRGDS), with a glycine spacer. This peptide forms amyloid-like fibrils and promotes formation of actin stress fibers that mediate fibroblast cell attachment, offering it potential as a bioadhesive for tissue regeneration and engineering. FN-A208 interacts with IKVAV receptors and integrins. Its activity is disrupted by the presence of EDTA.
Sequence:GRGDSGAASIKVAVSADR
MW:1716.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is of Histone H4 (1-23) biotinylated through a GGK linker on the C-terminus. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GGK(Biotin)-NH2
MW:2828.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Q4H7 Peptide (SIIQFEHL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIQFEHL
MW: 986.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1 to 21. It is phosphorylated at Ser10 with a C-terminal GG linker followed by a biotinylated lysine. The phosphorylation of Histone H3 at Ser10 is a mitotic marker and is associated with chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

G4 peptide (SIIGFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIGFEKL
MW: 906.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This linear peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions to inhibit C5a binding and function at human and rat C5a receptors. C5a is crucial to triggering cellular immune responses and its overexpression is involved in arthritis, Alzheimer’s disease, cystic fibrosis, systemic lupus erythematosus, and other immunoinflammatory diseases
Sequence:FKP-(D-Cha)-Wr
MW:886.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at arginine 17 with a C-terminal GG linker followed by a biotinylated lysine. The methylation of histone H3 at arginine 17 is linked with gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at lysine 9 with a C-terminal GG linker followed by a biotinylated lysine. The monomethylation of histone H3 at lysine 9 is dynamically and sex-differentially regulated during meiotic prophase. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a chromogenic substrate for thrombin, Abs=405 nm.
Sequence:f - Pip - R - pNA
MW:552.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C