Human Recombinant CXCL8 (IL-8) (from E. coli)
Supplier: CHEMOTACTICS, INC MS
Certificates
About this item
Recombinant Human CXCL8 (IL-8) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
Interleukin 8 (IL-8 )(CXCL8) is secreted primarily by macrophages and monocytes. It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for newtrophiles and monoccytes, and promotes activation of these target cells by binding to two cell surface receptors CXCR1 and CXCR2. It is also a strong angiogenic agent, and is considered to play a role in the pathogenesis of bronchiolitis.
Ordering information: Larger sizes available, please request a custom quote.
Delivery: Shipped lyophilized at room temperature.
Caution: For research use only, not for use in humans.
Specifications
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological activity:EC50 = 0.083 nM determined by Migration Assay in cells expressing recombinant CXCR1
- Gene ID:Accession # P10145 (28-99)
- Reconstitution instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-free:Y
- Protease-free:Y
- Protein synonyms:IL8|NAF|GCP1|LECT|LUCT|NAP1|GCP-1|LYNAP|MDNCF|MONAP|NAP-1|SCYB8
- Protein/peptide name:CXCL8 (IL-8)
- Purity:>97%
- Molecular weight:8.39 kDa
- Sequence:SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
- Endotoxin level:Very low
- Formulation:Lyophilized pellet
- Shipping temperature:RT
- Tested applications:Migration assay
Specifications
Frequently Bought Together