About this item
Recombinant Human CXCL12 (SDF-1a) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
As a chemoattractant active on T-lymphocytes, monocytes, but not neutrophils, SDF-1α activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1α (3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1α(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and Tlymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF-1α/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
Specifications
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological activity:EC50 = 0.62 nM determined by Calcium Flux with human CXCR4 in U937 cells EC50 = 0.17nM determined by Migration with U937 cells
- Gene ID:Accession # P48061-2 (22-89)
- Reconstitution instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-free:Y
- Protease-free:Y
- Protein synonyms:IRH|PBSF|SDF1|TLSF|TPAR1|SCYB12
- Protein/peptide name:CXCL12 (SDF-1a)
- Purity:>97%
- Molecular weight:7.96 kDa
- Sequence:KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Endotoxin level:Very low
- Formulation:Lyophilized pellet
- Shipping temperature:RT
- Tested applications:Migration assay; Calcium Flux