Human Recombinant CCL4 (MIP-1B) (from E. coli)
Recombinant Human CCL4 (MIP-1B) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
: Larger sizes available, please request a custom quote.
: Shipped lyophilized at room temperature.
: For research use only, not for use in humans.
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological activity:EC50 = 0.23 nM determined by Migration Assay in cells expressing recombinant CCR5
- Gene ID:Accession # P13236 (24-92)
- Reconstitution instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-free:Y
- Protease-free:Y
- Protein synonyms:ACT2|AT744.1|G-26|HC21|LAG-1|LAG1|MIP-1-beta|MIP1B|MIP1B1|SCYA2|SCYA4
- Protein/peptide name:CCL4 (MIP-1B)
- Purity:>97%
- Molecular weight:7.82 kDa
- Sequence:APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
- Endotoxin level:Very low
- Formulation:Lyophilized pellet
- Shipping temperature:RT
- Tested applications:Migration assay
Frequently Bought Together