Mouse Recombinant IL-19 (from E. coli)
Supplier: VWR International
New Product
Certificates
About this item
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
High quality
- Low endotoxin
- Affordable
Caution:
For research use only.
Specifications
- Conjugation:Unconjugated
- Protein Function:Cytokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Mouse
- Storage conditions:−20 °C
- Endotoxin content:Endotoxin LAL (EU/µg) ≤0.1
- Biological activity:Bioactivity: No biological activity data is available at this time
- Gene ID:Q8CJ70
- Reconstitution instructions:Sterile water at 0.1 mg/ml
- Endotoxin-free:N
- Carrier-free:Y
- Protease-free:N
- Animal-free:Y
- Protein/peptide name:IL-19
- Purity:≥95%
- Molecular weight:17.7 kDa
- Sequence:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Endotoxin level:Low
- Formulation:10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
- Nuclease-free:N
- Grade:RUO
- Shipping temperature:RT
Specifications
Frequently Bought Together