Human Recombinant IGF1 (from E. coli)
Supplier: Creative Biomart
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:4 °C
- Endotoxin content:<0.01 EU/µg of rHuIGF-1 as determined by LAL method
- Reconstitution instructions:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1 - 1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤−20 °C. Further dilutions should be made in appropriate buffered solutions.
- Endotoxin-free:No
- Carrier-free:No
- Protease-free:No
- Animal-free:No
- Protein synonyms:Insulin-like growth factor 1
- UniProtKB:P05019
- Protein/peptide name:IGF1
- Purity:>97% by SDS-PAGE and HPLC analysis
- Molecular weight:Approximately 7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids
- Sequence:GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Endotoxin level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping temperature:20
Specifications
Frequently Bought Together