Recombinant Human IL6 (from E. coli)
Catalog # 77539-988
Supplier: Creative Biomart
CAS Number:
Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Storage conditions:4 °C
- Endotoxin content:<1.0 EU/µg of rHuIL-6 as determined by LAL method
- Reconstitution instructions:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1 - 1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤−20 centigrade. Further dilutions should be made in appropriate buffered solutions.
- Endotoxin-free:No
- Carrier-free:No
- Protease-free:No
- Animal-free:No
- Protein synonyms:interleukin 6
- UniProtKB:P05231
- Protein/peptide name:IL6
- Purity:>96% by SDS-PAGE and HPLC analysis
- Molecular weight:Approximately 20.8 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids.
- Sequence:VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Endotoxin level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping temperature:20
- Cat. no.:77539-988