Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) fbpA (from E. coli)
Supplier: Creative Biomart
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Mycobacterium tuberculosis (strain CDC 1551/Oshkosh)
- Storage conditions:4 °C
- Reconstitution instructions:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1 - 1.0 mg/ml.We recommend to add 5 - 50% of glycerol (final concentration) and aliquot for long-term storage at −20/−80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Endotoxin-free:No
- Carrier-free:No
- Protease-free:No
- Animal-free:No
- Protein synonyms:ferric binding protein
- UniProtKB:P9WQP2
- Protein/peptide name:fbpA
- Purity:>90% as determined by SDS-PAGE
- Molecular weight:34.1 kDa
- Sequence:YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT
- Endotoxin level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping temperature:20
Specifications
Frequently Bought Together