Anti-MBD3 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to MBD3 for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:200 to 1:200
Type: Primary
Antigen: MBD3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
Specifications
- Catalog No:
- 76856-060
- Antigen symbol:
- MBD3
- Antigen name:
- AI181826
- Antigen synonyms:
- MBD3|Methyl CpG binding protein MBD3|MBD3: methyl CpG binding domain protein 3|Methyl-CpG-binding protein MBD3|MBD 3|Methyl-CpG-binding domain protein 3|AU019209|MBD3_HUMAN
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O95983
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MBD3 (NP_001268383.1)
- Sequence:
- MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPE
- Form:
- Liquid
- Molecular weight:
- 36 kDa
- Purification:
- Affinity purification.
- Storage buffer:
- Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:
- Shipped on blue ice at +4 °C
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning