Anti-PTBP2 Rabbit Monoclonal Antibody [clone: ARC1798]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC1798] antibody to PTBP2 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: PTBP2
Clonality: Monoclonal
Clone: ARC1798
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Specifications
- Catalog No:
- 77224-772
- Antigen symbol:
- PTBP2
- Antigen name:
- brPTB
- Antigen synonyms:
- Neural polypyrimidine tract-binding protein|nPTB 6|MIBP|nPTB 5|Neural polypyrimidine tract binding protein|FLJ34897|Neurally enriched homolog of PTB|Neurally-enriched homolog of PTB|nPTB
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1798
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9UKA9
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9).
- Sequence:
- MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLE
- Form:
- Liquid
- Molecular weight:
- 57 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC, ICC/IF
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH