Anti-HPRT Rabbit Monoclonal Antibody [clone: ARC1300]
Rabbit monoclonal [ARC1300] antibody to HPRT for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: HPRT
Clonality: Monoclonal
Clone: ARC1300
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products, please provide identification that includes your business name and shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of identification are:
- • Issued document with your organization's Federal Tax ID Number
- • Government issued document with your organization's Resale Tax ID Number
- • Any other Government ID that includes the business name and address
Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 77220-154
- Antigen symbol:
- HPRT
- Antigen name:
- HGPRT
- Antigen synonyms:
- HGPRTase|Hypoxanthine-guanine phosphoribosyltransferase|Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome)|HPRT 1|Hypoxanthine phosphoribosyltransferase 1|HPRT1|Hypoxanthine guanine phosphoribosyltransferase|HPRT|HPRT_HUMAN
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1300
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P00492
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (P00492).
- Sequence:
- GDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
- Form:
- Liquid
- Molecular weight:
- 25 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together
VWR® Disposable Serological Pipettes
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Disposable Petri Dishes
: VWR International