Anti-Rab20 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to Rab20 for WB and ICC/IF with samples derived from Mouse.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Rab20
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse
Specifications
- Catalog No:
- 77232-912
- Antigen symbol:
- Rab20
- Antigen name:
- FLJ20429
- Antigen synonyms:
- RAB20_HUMAN|Ras-related protein Rab-20|RAB20 member RAS oncogene family|Rab20|Ras related protein Rab20
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9NX57
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 80-190 of human RAB20 (NP_060287.1).
- Sequence:
- YDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNV
- Form:
- Liquid
- Molecular weight:
- 26 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:
- Shipped on blue ice at +4 °C
- Tested applications:
- ICC/IF
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH