Anti-ALDH1A1 Rabbit Monoclonal Antibody [clone: ARC52440]
Rabbit monoclonal [ARC52440] antibody to ALDH1A1 for WB, ICC/IF and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF, IP
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:500 to 1:1,000, IP: 1:500 to 1:1,000
Type: Primary
Antigen: ALDH1A1
Clonality: Monoclonal
Clone: ARC52440
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
- Catalog No:
- 77232-354
- Antigen symbol:
- ALDH1A1
- Antigen name:
- Acetaldehyde dehydrogenase 1
- Antigen synonyms:
- AHD2|AL1A1_HUMAN|Aldehyde dehydrogenase 1 soluble|Aldehyde dehydrogenase|Aldehyde dehydrogenase cytosolic|ALDC|Aldehyde dehydrogenase family 1 member A1|Aldehyde dehydrogenase 1A1|Aldehyde dehydrogenase 1 family member A1
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC52440
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P00352
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- ImmunoPrecipitation:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2).
- Sequence:
- VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
- Form:
- Liquid
- Molecular weight:
- 55 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:
- Shipped on blue ice at +4 °C
- Tested applications:
- ICC/IF
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Disposable Petri Dishes
: VWR International