Anti-FOXO3A Rabbit Monoclonal Antibody [clone: ARC1505]
Supplier: Antibodies.com
Certificates
About this item
Rabbit monoclonal [ARC1505] antibody to FOXO3A for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: FOXO3A
Clonality: Monoclonal
Clone: ARC1505
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse
Specifications
- Catalog No:
- 77231-236
- Antigen symbol:
- FOXO3A
- Antigen name:
- AF6q21
- Antigen synonyms:
- Forkhead box O3|FKHRL1P2|DKFZp781A0677|Forkhead box O3A|FKHRL 1|FKHRL1|Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1|AF6q21 protein|FKHR2
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1505
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O43524
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (O43524)
- Sequence:
- SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
- Form:
- Liquid
- Molecular weight:
- 90 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Frequently Bought Together
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Disposable Petri Dishes
Supplier: VWR International
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International