Anti-SETD1B Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to SETD1B for WB with samples derived from Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: SETD1B
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat
Specifications
- Catalog No:
- 77230-664
- Antigen symbol:
- SETD1B
- Antigen name:
- FLJ20803
- Antigen synonyms:
- Lysine N-methyltransferase 2G|SET domain-containing protein 1B|KMT2G|hSET1B|KIAA1076|SET domain containing 1B|KMT2G / hSET1B|Histone-lysine N-methyltransferase SETD1B|SET1B_HUMAN
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9UPS6
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1673-1770 of human SETD1B (NP_001340274.1)
- Sequence:
- SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRAS
- Form:
- Liquid
- Molecular weight:
- 250 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Disposable Petri Dishes
Supplier: VWR International