Anti-USP11 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to USP11 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: USP11
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
- Catalog No:
- 77229-080
- Antigen symbol:
- USP11
- Antigen name:
- Deubiquitinating enzyme 11
- Antigen synonyms:
- Ubiquitin-specific-processing protease 11|UHX1|USP11|Ubiquitin thiolesterase 11|Ubiquitin specific protease 11|ubiquitin specific peptidase 11|UBP11_HUMAN|Ubiquitin carboxyl-terminal hydrolase 11|Ubiquitin carboxyl-terminal hydrolase X linked
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P51784
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human USP11 (NP_004642.2)
- Sequence:
- PQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQ
- Form:
- Liquid
- Molecular weight:
- 110 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- ICC/IF
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Disposable Petri Dishes
: VWR International