Anti-AK2 Rabbit Polyclonal Antibody
76855-860
- Antibody type:Primary
- Antigen name:Adenylate kinase 2
- Antigen symbol:AK2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Size:100 µl
- Form:Liquid
- Gene ID:UniprotID# P54819
- Antigen synonyms:, mitochondrial|AK2|AK 2|ATP AMP transphosphorylase|Adenylate kinase isoenzyme 2|EC 2.7.4.3|ADK2|ATP-AMP transphosphorylase 2|KAD2_HUMAN
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Molecular weight:26 kDa
- Sequence:MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATC
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 232 of human AK2 (NP_001616.1)
- Tested applications:IHC
- Purification:Affinity purification
- Cat. no.:76855-860
- Packaging:Plastic vial
Rabbit polyclonal antibody to AK2 for WB and IHC with samples derived from Human and Mouse.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: AK2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse