Anti-COP1 Rabbit Polyclonal Antibody
Supplier: Antibodies.com
About this item
Rabbit polyclonal antibody to COP1 for WB and IHC with samples derived from Human, Mouse and Rat.
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:100 to 1:200
Caution: This product is for Research Use Only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: COP1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
1 Options Available Below
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Rabbit polyclonal antibody to COP1 for WB and IHC with samples derived from Human, Mouse and Rat.
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:100 to 1:200
Caution: This product is for Research Use Only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: COP1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Documents
Specifications for Product Family
Specifications
- Catalog No:
- 76856-148
- 76867-882
- Antigen symbol:
- COP1
- COP1
- Antigen name:
- Constitutive photomorphogenesis protein 1 homolog
- Constitutive photomorphogenesis protein 1 homolog
- Antigen synonyms:
- ring finger and WD repeat domain 2|E3 ubiquitin-protein ligase RFWD2|COP1|COP|RING finger and WD repeat domain protein 2|RFWD2_HUMAN|RING finger protein 200|hCOP1
- Constitutive photomorphogenesis protein 1 homolog|E3 ubiquitin-protein ligase COP1|hCOP1|RFWD2|RING finger and WD repeat domain protein 2|RING finger protein 200|RING-type E3 ubiquitin transferase RFWD2|RNF200
- Antibody type:
- Primary
- Primary
- Clonality:
- Polyclonal
- Polyclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Reactivity:
- Human|Rat|Mouse
- Human|Rat|Mouse
- Host:
- Rabbit
- Rabbit
- Gene ID:
- UniprotID# Q8NHY2
- UniprotID# Q8NHY2
- Isotype:
- IgG
- IgG
- Western blot:
- Yes
- Yes
- ImmunoChemistry:
- Yes
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 582 - 731 of human RFWD2 (NP_071902.2)
- Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2)
- Sequence:
- YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
- YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
- Form:
- Liquid
- Liquid
- Molecular weight:
- 110 kDa
- 110 kDa
- Purification:
- Affinity purification
- Affinity purification.
- Concentration:
- Lot specific
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC
- IHC
Specifications
Product Family Options
Product Information
- SizePackagingAvailabilityPrice
- 50 µlPlastic vialDiscontinued-Supplier Number: -Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.76856-148Antigen symbolCOP1Antigen nameConstitutive photomorphogenesis protein 1 homologAntigen synonymsring finger and WD repeat domain 2|E3 ubiquitin-protein ligase RFWD2|COP1|COP|RING finger and WD repeat domain protein 2|RFWD2_HUMAN|RING finger protein 200|hCOP1Antibody typePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|Rat|MouseHostRabbitGene IDUniprotID# Q8NHY2IsotypeIgGWestern blotYesImmunoChemistryYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 582 - 731 of human RFWD2 (NP_071902.2)SequenceYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELVFormLiquidMolecular weight110 kDaPurificationAffinity purificationConcentrationStorage bufferSupplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium AzideStorage temperatureShipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.Shipping temperatureShipped on blue ice at 4 °CTested applicationsIHC - Supplier Number: A11320-100Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.76867-882Antigen symbolCOP1Antigen nameConstitutive photomorphogenesis protein 1 homologAntigen synonymsConstitutive photomorphogenesis protein 1 homolog|E3 ubiquitin-protein ligase COP1|hCOP1|RFWD2|RING finger and WD repeat domain protein 2|RING finger protein 200|RING-type E3 ubiquitin transferase RFWD2|RNF200Antibody typePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|Rat|MouseHostRabbitGene IDUniprotID# Q8NHY2IsotypeIgGWestern blotYesImmunoChemistryYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2)SequenceYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELVFormLiquidMolecular weight110 kDaPurificationAffinity purification.ConcentrationLot specificStorage bufferSupplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium AzideStorage temperatureUpon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.Shipping temperatureShipped on blue ice at 4 °CTested applicationsIHC
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.
KIMTECH SCIENCE® KIMWIPES™ Delicate Task Wipers, KIMBERLY-CLARK PROFESSIONAL®
Catalog #: CA21905-026
Supplier: Kimberly-Clark