Anti-Syntaxin 8 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to Syntaxin 8 for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Syntaxin 8
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse
Specifications
- Catalog No:
- 76850-884
- Antigen symbol:
- Syntaxin 8
- Antigen name:
- CARB
- Antigen synonyms:
- STX 8|Syntaxin8|STX8_HUMAN|Stx8|Syntaxin 8|Syntaxin-8
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9UNK0
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 215 of human STX8 (NP_004844.1)
- Sequence:
- MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
- Form:
- Liquid
- Molecular weight:
- 27 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH