Anti-RGS20 Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to RGS20 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: RGS20
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Specifications
- Catalog No:
- 76866-930
- Antigen symbol:
- RGS20
- Antigen name:
- Regulator of Gz-selective protein signaling 1
- Antigen synonyms:
- HGNC:14600|Regulator of Gz selective protein signaling 1|G(z)GAP|Gz selective GTPase activating protein|Regulator of G-protein signaling Z1|Regulator of G-protein signaling 20|Gz-selective GTPase-activating protein|Gz-GAP|Regulator of G protein signaling 20
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O76081
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 241 of human RGS20 (NP_003693.2)
- Sequence:
- MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
- Form:
- Liquid
- Molecular weight:
- 44 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH