Anti-Hemoglobin subunit zeta Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to Hemoglobin subunit zeta for WB with samples derived from Human.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Hemoglobin subunit zeta
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
- Catalog No:
- 76849-084
- Antigen symbol:
- Hemoglobin subunit zeta
- Antigen name:
- Hemoglobin zeta
- Antigen synonyms:
- HBZ2|Hemoglobin subunit zeta|HBAZ|chain|HBZ|Zeta-globin|HBAZ_HUMAN|Zeta globin|HBZ 2
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human
- Host:
- Rabbit
- Gene ID:
- UniprotID# P02008
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 142 of human HBZ (NP_005323.1)
- Sequence:
- MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
- Form:
- Liquid
- Molecular weight:
- 13 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Disposable Petri Dishes
: VWR International