Anti-MMP14 Rabbit Monoclonal Antibody [Clone: ARC0211]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC0211] antibody to MMP14 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: MMP14
Clonality: Monoclonal
Clone: ARC0211
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Specifications
- Catalog No:
- 77220-062
- Antigen symbol:
- MMP14
- Antigen name:
- Matrix metallopeptidase 14 (membrane inserted)
- Antigen synonyms:
- MMP 14|Membrane type matrix metalloproteinase 1|Membrane-type-1 matrix metalloproteinase|Matrix metalloproteinase-14|MMP X1|Membrane-type matrix metalloproteinase 1|Membrane type 1 matrix metalloproteinase|Matrix metalloproteinase 14|Membrane type 1 metalloprotease
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC0211
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P50281
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (P50281).
- Sequence:
- GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
- Form:
- Liquid
- Molecular weight:
- 52 kDa / 60 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Specifications
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
Supplier: VWR International
VWR® Nitrile Examination Gloves, Blue
Supplier: VWR International
VWR® Disposable Petri Dishes
Supplier: VWR International
Falcon® Centrifuge Tubes, Conical Bottom, Corning
Supplier: Corning
pH Reference Standard Buffers, VWR Chemicals BDH®
Supplier: BDH
VWR® Universal Pipette Tips
Supplier: VWR International
VWR® Microcentrifuge Tubes, PP
Supplier: VWR International