Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Size:1 mg
- Storage conditions:–20 °C
- Protein synonyms:C-terminal heptad repeat 2 Peptide|HR2|heptad repeat 2 Peptide
- Protein/peptide name:C34, gp41 HIV Fragment
- Purity:95%
- Molecular weight:4248.6 Da
- Sequence:WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
- Cat. no.:103007-194
- Supplier No.:AS-62101
This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.
Sequence:WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
MW:4248.6 Da
% peak area by HPLC:95
Storage condition:-20° C