Order Entry
Canada
ContactUsLinkComponent
Beta-Amyloid A4 Protein Precursor (740-770)
Beta-Amyloid A4 Protein Precursor (740-770)
Catalog # 103007-180
Supplier:  Anaspec Inc
CAS Number:  
Beta-Amyloid A4 Protein Precursor (740-770)
Catalog # 103007-180
Supplier:  Anaspec Inc
Supplier Number:  AS-62073
CAS Number:  

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment. 

Specifications

  • Conjugation:
    Unconjugated
  • Size:
    1 mg
  • Storage conditions:
    –20 °C
  • Protein synonyms:
    beta-Amyloid (740-770)|APP C31 ppetide|beta-Amyloid A4 Precursor|APP (C31) Peptide
  • Protein/peptide name:
    beta-Amyloid A4 Protein Precursor (740-770)
  • Purity:
    95%
  • Molecular weight:
    3717.1 Da
  • Sequence:
    AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
  • Cat. no.:
    103007-180
  • Supplier No.:
    AS-62073

Specifications

About this item

APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C