Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Species:Human
- Size:1 mg
- Storage conditions:–20 °C
- Protein synonyms:Glucagon-like Peptide-2 (146-178)
- Protein/peptide name:Glucagon-like Peptide-2, GLP-2 (146-178)
- Purity:95%
- Molecular weight:3766.2 Da
- Sequence:HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Cat. no.:103007-176
- Supplier No.:AS-62070
Specifications
About this item
This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
MW: 3766.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C