About this item
GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Species:Rat
- Storage conditions:–20 °C
- Protein synonyms:Gastric-inhibitory polypeptide|Glucose-dependent Insulinotropic Polypeptide|GIP rat GIP|Insulinotropic Peptide
- Protein/peptide name:GIP
- Purity:95%
- Molecular weight:5002.95 Da
- Sequence:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Specifications
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: BDH
Supplier: VWR International
Supplier: VWR International
Supplier: Corning