Human Brain Natriuretic Peptide 32

About this item

This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.