Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Species:RatMouse
- Size:1 mg
- Storage conditions:–20 °C
- Protein synonyms:abeta (1-38)|amyloid 1-38|amyloid beta (1-38)|beta amyloid 1-38
- Protein/peptide name:beta-Amyloid (1-38)
- Purity:95%
- Molecular weight:4035.5 Da
- Sequence:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
- Cat. no.:103007-364
- Supplier No.:AS-62476
This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C