Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Species:Human
- Size:1 mg
- Storage conditions:–20 °C
- Protein synonyms:amyloid beta (11-40)|beta amyloid 11-40|abeta (11-40)|amyloid 11-40
- Protein/peptide name:beta-Amyloid (11-40)
- Purity:95%
- Molecular weight:3151.7 Da
- Sequence:EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. no.:103005-822
- Supplier No.:AS-60017-1
Specifications
About this item
Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C