Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Species:Human
- Size:0.5 mg
- Storage conditions:–20 °C
- Protein synonyms:beta amyloid (1-40) Dutch/Iowa double mutation|amyloid 1-40 Dutch/Iowa double mutation|amyloid beta (1-40) Dutch/Iowa double mutation|abeta (1-40) Dutch/Iowa double mutation
- Protein/peptide name:[Gln22, Asn23]-beta-Amyloid (1-40)
- Purity:95%
- Molecular weight:4327.9 Da
- Sequence:DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
- Cat. no.:103007-212
- Supplier No.:AS-62146
This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C