Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:HiLyte™ Fluor 647
- Species:Human
- Size:0.1 mg
- Storage conditions:–20 °C
- Protein synonyms:amyloid beta (1-40) HiLyte™ Fluor 647|abeta (1-40) HiLyte™ Fluor 647|amyloid 1-40 HiLyte™ Fluor 647|beta amyloid (1-40) HiLyte™ Fluor 647
- Protein/peptide name:beta-Amyloid (1-40)
- Purity:95%
- Molecular weight:5315.4 Da
- Sequence:HiLyte™ Fluor 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. no.:103003-182
- Supplier No.:AS-60493
This is a fluorescent (HiLyte™ Fluor 647)-labeled ß-Amyloid peptide, Abs/Em = 649/674 nm.
Sequence: HiLyte™ Fluor 647 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
% Peak Area by HPLC: ≥95