Order Entry
Anti-TLR5 Goat Polyclonal Antibody
Catalog #: 89361-040
Supplier:  Genetex
Log in for availability
Unit of Measure Each (100µG)
Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.


  • Antibody type:
  • Antigen name:
    Toll-like Receptor 5
  • Clonality:
  • Gene ID:
  • Host:
  • Isotype:
  • Reactivity:
  • Antigen symbol:
  • Conjugation:
  • ELISA:
  • ImmunoChemistry:
  • ImmunoFluorescence:
  • Antigen synonyms:
    Toll-like receptor 5
    Toll/interleukin-1 receptor-like protein 3
  • Storage buffer:
    PBS, 1mg/ml BSA, 0.1% sodium azide, pH7.2
  • Storage temperature:
    Aliquot and store at -20 to -80 °C
  • Concentration:
    2 mg/ml
  • Immunogen:
    Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, corresponding to amino acids 151-181 of Human TLR5.
  • Tested applications:
  • Purification:
    Immunogen affinity purified
  • Cat. no.:
  • Size:
    100 μg


About this item