You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Human Recombinant Growth Hormone 2 (from E. coli)
Supplier: R&D Systems
The Recombinant Human Growth Hormone 2 Protein from R&D Systems is derived from E. coli. The Recombinant Human Growth Hormone 2 Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
[Lys0]-Bradykinin (Kallidin)
Supplier: Anaspec Inc
[Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human Recombinant LDL R (from NS0 cells)
Supplier: R&D Systems
The Recombinant Human LDL R (High Purity) Protein from R&D Systems is derived from NS0. The Recombinant Human LDL R (High Purity) Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant SEMA3D (from CHO cells)
Supplier: R&D Systems
The Recombinant Mouse Semaphorin 3D Fc Chimera Protein from R&D Systems is derived from CHO. The Recombinant Mouse Semaphorin 3D Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant Tumor necrosis Factor Receptor Superfamily Member 3
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Mouse Recombinant Tumor necrosis Factor Receptor Superfamily Member 21
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Mouse Recombinant Regenerating Islet-derived 2
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Histone H2A (1-20)
Supplier: Anaspec Inc
This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Platelet receptor Gi24
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Histone H3 (21-44)
Supplier: Anaspec Inc
This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG
MW:2505.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Recombinant Cytosolic Sulfotransferase 1C2/SULT1C2 (from E. coli)
Supplier: R&D Systems
The Recombinant Human SULT1C2 Protein from R&D Systems is derived from E. coli. The Recombinant Human SULT1C2 Protein has been validated for the following applications: Enzyme Activity.
Expand 1 Items
Mouse Recombinant Leptin R (from NS0 Cells)
Supplier: R&D Systems
The Recombinant Mouse Leptin R Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Mouse Leptin R Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
GALA, Pore-Forming Peptide
Supplier: Anaspec Inc
GALA is a 30 amino acid synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat. It also contains a histidine and tryptophan residue as spectroscopic probes. This peptide was designed to explore how viral fusion protein sequences interact with membranes. It was used to study the importance of the helix length, hydrophobicity, and hydrophobic moment on the formation, structure, and function of ion channels. The membrane-interacting properties of GALA have been extensively documented. Investigations with analogs of cytotoxic peptides clarify the importance of peptide charge and the role of particular amino acids or arrays of amino acids in the conformation, membrane-binding affinity, and pore-forming abilities of these toxins.
Sequence:WEAALAEALAEALAEHLAEALAEALEALAA
MW:3032.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Gila Biotin-Exendin 4,Biotin
Supplier: Anaspec Inc
This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Mouse Recombinant FCRL1/FcRH1 (from NS0 Cells)
Supplier: R&D Systems
The Recombinant Mouse FCRL1/FcRH1 Protein from R&D Systems is derived from NS0. The Recombinant Mouse FCRL1/FcRH1 Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant Glycine N-Methyltransferase/GNMT (from E. coli)
Supplier: R&D Systems
The Recombinant Human Glycine N-methyltransferase/GNMT from R&D Systems is derived from E. coli. The Recombinant Human Glycine N-methyltransferase/GNMT has been validated for the following applications: Enzyme Activity.
Expand 1 Items
Human Recombinant Wnt-3a (from CHO Cells)
Supplier: R&D Systems
The Recombinant Human Wnt-3a Protein from R&D Systems is derived from CHO. The Recombinant Human Wnt-3a Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Mouse Recombinant CD155/PVR (from NS0 cells)
Supplier: R&D Systems
The Recombinant Mouse CD155/PVR His-tag Protein from R&D Systems is derived from NS0. The Recombinant Mouse CD155/PVR His-tag Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Apidaecin IB
Supplier: Anaspec Inc
Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, but is devoid of any pore-forming activity. Apidaecins are the most prominent components of the honey bee humoral defense against microbial invasion.
Sequence:GNNRPVYIPQPRPPHPRL
MW:2108.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Beta-Amyloid (1-40), HiLyte™ Fluor 647
Supplier: Anaspec Inc
This is a fluorescent (HiLyte™ Fluor 647)-labeled ß-Amyloid peptide, Abs/Em = 649/674 nm.
Expand 1 Items
SARS-CoV-2 Recombinant S protein (from HEK293), Precision Avi
Supplier: ACROBIOSYSTEMS INC MS
SARS-CoV-2 S protein trimer, His, Avitag* (MALS verified), Biotinylated, Source: expressed from HEK293 with T4 fibritin trimerization motif and a polyhistidine tag at the C-terminus, Predicted N-terminus: Val 16, Synonyms: Spike, S protein, Spike glycoprotein, S glycoprotein, Size: 200uG
Expand 1 Items
SARS-CoV-2 Recombinant S protein (from HEK293), Precision Avi
Supplier: ACROBIOSYSTEMS INC MS
SARS-CoV-2 S protein trimer, His, Avitag* (MALS verified), Biotinylated, Source: expressed from HEK293 with T4 fibritin trimerization motif and a polyhistidine tag at the C-terminus, Predicted N-terminus: Val 16, Synonyms: Spike, S protein, Spike glycoprotein, S glycoprotein, Size: 200uG
Expand 1 Items
Human;Rat Neuropeptide Y
Supplier: Anaspec Inc
Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Human Recombinant CMRF35-Like Molecule 6
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
TP53 Q9NP68
Supplier: Anaspec Inc
This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence:KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2133.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Renin 390 FRET Substrate I
Supplier: Anaspec Inc
This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS), acting through type 1 angiotensin (AT1) receptors, is a master regulator of fluid homeostasis.
Sequence:R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
MW:2282.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human Recombinant Mucin-1 (from HEK293 Cells)
Supplier: ACROBIOSYSTEMS INC MS
Human Mucin-1 / MUC-1 (890-1158) Protein, His Tag, ACROBiosystems
Expand 1 Items
Human Recombinant Acetylcholinesterase/ACHE (from CHO cells)
Supplier: R&D Systems
The Recombinant Human Acetylcholinesterase/ACHE Protein from R&D Systems is derived from CHO. The Recombinant Human Acetylcholinesterase/ACHE Protein has been validated for the following applications: Enzyme Activity.
Expand 1 Items
Human Recombinant EphA7 (from NS0 cells)
Supplier: R&D Systems
The Recombinant Human EphA7 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human EphA7 Fc Chimera Protein has been validated for the following applications: Bioactivity.
Expand 1 Items
Human Recombinant Growth/differentiation factor 8
Supplier: Bon Opus Biosciences
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Expand 4 Items
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: Ansell Canada
Supplier: Akro-Mils
Supplier: VWR International
Supplier: SCN INDUSTRIAL CA
Supplier: VWR International
Supplier: Kimberly-Clark
Supplier: Medicom