You searched for: Proteins and Peptides

Supplier: Anaspec Inc

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
MW: 3659.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: ACROBIOSYSTEMS INC MS

Human CD30/TNFRSF8 Protein, His Tag, PE-Labeled, Source: expressed from human 293 cells (HEK293). It contains AA Phe 19 - Lys 379, Predicted N-terminus: Phe 19, protein carries an Avi tag at the C-terminus, followed by a polyhistidine tag, Synonyms: TNFRSF8, CD30, D1S166E, Ki-1, Size: 25tests

Supplier: ACROBIOSYSTEMS INC MS

Human CEACAM-5/CD66e Protein, His Tag (MALS verified), FITC-Labeled, Source: expressed from HEK293. It contains AA Lys 35 - Ala 685, Predicted N-terminus: Lys 35, protein carries a polyhistidine tag at the C-terminus, Synonyms: CEACAM-5, CD66e, CEA, Meconium antigen 100, Size: 200uG

Supplier: Anaspec Inc

This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2
MW: 1773 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: R&D Systems

The Recombinant Human KIR2DL5/CD158f Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human KIR2DL5/CD158f Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human Cerebellin-1 Protein from R&D Systems is derived from CHO. The Recombinant Human Cerebellin-1 Protein has been validated for the following applications: Bioactivity.

Supplier: Creative Biomart

Recombinant Human GPC4 (from E. coli)

Supplier: R&D Systems

The Recombinant Human Neuronal Pentraxin 2 Protein from R&D Systems is derived from NS0. The Recombinant Human Neuronal Pentraxin 2 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse Plexin B2 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Plexin B2 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse CLEC9a Fc Chimera Protein from R&D Systems is derived from CHO. The Recombinant Mouse CLEC9a Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Rat CCL3/MIP-1 alpha Protein from R&D Systems is derived from E. coli. The Recombinant Rat CCL3/MIP-1 alpha Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human VEGF 165 Protein from R&D Systems is derived from Sf 21 (baculovirus). The Recombinant Human VEGF 165 Protein has been validated for the following applications: Bioactivity.

Supplier: Creative Biomart

Recombinant Human DDX53 (from E. coli)

Supplier: Creative Biomart

Recombinant Human F13A1 (from E. coli)

Supplier: Creative Biomart

Recombinant Human ARG2 (from E. coli)

Supplier: ACROBIOSYSTEMS INC MS

SARS-CoV-2 S1 protein NTD (HV69-70del, Y144del), His Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Ser 13 - Leu 303, Predicted N-terminus: Ser 13, protein carries a polyhistidine tag at the C-terminus, Synonyms: S1 protein NTD, Spike protein S1 NTD, Size: 100uG

Supplier: Creative Biomart

Recombinant GFP (from E. coli)

Supplier: Creative Biomart

Human Recombinant EPAS1 (from E. coli)

Supplier: Anaspec Inc

28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: ACROBIOSYSTEMS INC MS

Human PD-1/PDCD1 Full Length Protein, His Tag, Source: expressed from human 293 cells (HEK293). It contains AA Leu 25 - Leu 288, Predicted N-terminus: Leu 25, protein carries a polyhistidine tag at the C-terminus, Synonyms: PDCD1, PD1, CD279, SLEB2, Size: 500uG

Supplier: ACROBIOSYSTEMS INC MS

Human NCAM-1/CD56 Protein, His Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 20 - Gly 718, Predicted N-terminus: Leu 20, protein carries a polyhistidine tag at the C-terminus, Synonyms: CD56, MSK39, NCAM1, N-CAM-1, Size: 100uG

Supplier: ACROBIOSYSTEMS INC MS

Human NOTCH2 Protein, Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 26 - Gln 530, Predicted N-terminus: Leu 26, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: NOTCH2, hN2, N2ECD, Size: 100uG

Supplier: R&D Systems

The Recombinant Botulinum Neurotoxin Type D Light Chain from R&D Systems is derived from E. coli. The Recombinant Botulinum Neurotoxin Type D Light Chain has been validated for the following applications: Enzyme Activity.

Supplier: Creative Biomart

Human Recombinant BMP2 (from E. coli)

Supplier: R&D Systems

The Recombinant Mouse ST7/LRP12 Protein from R&D Systems is derived from CHO. The Recombinant Mouse ST7/LRP12 Protein has been validated for the following applications: Bioactivity.