Order Entry
Canada
ContactUsLinkComponent
 

You searched for: Proteins and Peptides

Proteins and Peptides

Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.

Human ACTH (7-38)

Supplier: Anaspec Inc

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
MW: 3659.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Humantreml2 Cc39, Bon Opus Biosciences

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Expand 4 Items
Loading...

Human Pdcd1 Cd91, Bon Opus Biosciences

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Expand 4 Items
Loading...

Human Recombinant CD30 (from HEK293), PE Labeled Protein

Supplier: ACROBIOSYSTEMS INC MS

Human CD30/TNFRSF8 Protein, His Tag, PE-Labeled, Source: expressed from human 293 cells (HEK293). It contains AA Phe 19 - Lys 379, Predicted N-terminus: Phe 19, protein carries an Avi tag at the C-terminus, followed by a polyhistidine tag, Synonyms: TNFRSF8, CD30, D1S166E, Ki-1, Size: 25tests

Expand 1 Items
Loading...

Human Recombinant CEACAM-5 (from HEK293), FITC Labeled Protein

Supplier: ACROBIOSYSTEMS INC MS

Human CEACAM-5/CD66e Protein, His Tag (MALS verified), FITC-Labeled, Source: expressed from HEK293. It contains AA Lys 35 - Ala 685, Predicted N-terminus: Lys 35, protein carries a polyhistidine tag at the C-terminus, Synonyms: CEACAM-5, CD66e, CEA, Meconium antigen 100, Size: 200uG

Expand 1 Items
Loading...

Chicken OVA (323-339)

Supplier: Anaspec Inc

This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2
MW: 1773 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Recombinant KIR2DL5/CD158f (from NS0 cells)

Supplier: R&D Systems

The Recombinant Human KIR2DL5/CD158f Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human KIR2DL5/CD158f Fc Chimera Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Human Recombinant Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Expand 4 Items
Loading...

Human Recombinant Repulsive guidance molecule A

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Expand 4 Items
Loading...

Human Recombinant Macrophage migration inhibitory factor

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Expand 4 Items
Loading...

Human Recombinant Cerebellin-1/Precerebellin (from CHO Cells)

Supplier: R&D Systems

The Recombinant Human Cerebellin-1 Protein from R&D Systems is derived from CHO. The Recombinant Human Cerebellin-1 Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...
Recombinant Human GPC4 (from E. coli)

Recombinant Human GPC4 (from E. coli)

Supplier: Creative Biomart

Recombinant Human GPC4 (from E. coli)

Expand 2 Items
Loading...

Human Recombinant Neuronal Pentraxin 2 (from NS0 Cells)

Supplier: R&D Systems

The Recombinant Human Neuronal Pentraxin 2 Protein from R&D Systems is derived from NS0. The Recombinant Human Neuronal Pentraxin 2 Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Mouse Recombinant Plexin B2 (from CHO Cells)

Supplier: R&D Systems

The Recombinant Mouse Plexin B2 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Plexin B2 Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Mouse Recombinant CLEC9a (from CHO cells)

Supplier: R&D Systems

The Recombinant Mouse CLEC9a Fc Chimera Protein from R&D Systems is derived from CHO. The Recombinant Mouse CLEC9a Fc Chimera Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Rat Recombinant CCL3/MIP-1 alpha (from E. coli)

Supplier: R&D Systems

The Recombinant Rat CCL3/MIP-1 alpha Protein from R&D Systems is derived from E. coli. The Recombinant Rat CCL3/MIP-1 alpha Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Human Recombinant VEGF (from Baculovirus (Sf21 Insect Cells))

Supplier: R&D Systems

The Recombinant Human VEGF 165 Protein from R&D Systems is derived from Sf 21 (baculovirus). The Recombinant Human VEGF 165 Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...
Recombinant Human DDX53 (from E. coli)

Recombinant Human DDX53 (from E. coli)

Supplier: Creative Biomart

Recombinant Human DDX53 (from E. coli)

Expand 1 Items
Loading...
Recombinant Human F13A1 (from E. coli)

Recombinant Human F13A1 (from E. coli)

Supplier: Creative Biomart

Recombinant Human F13A1 (from E. coli)

Expand 1 Items
Loading...
Recombinant Human ARG2 (from E. coli)

Recombinant Human ARG2 (from E. coli)

Supplier: Creative Biomart

Recombinant Human ARG2 (from E. coli)

Expand 2 Items
Loading...

SARS-CoV-2 Recombinant S1 protein NTD (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS INC MS

SARS-CoV-2 S1 protein NTD (HV69-70del, Y144del), His Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Ser 13 - Leu 303, Predicted N-terminus: Ser 13, protein carries a polyhistidine tag at the C-terminus, Synonyms: S1 protein NTD, Spike protein S1 NTD, Size: 100uG

Expand 1 Items
Loading...
Recombinant GFP (from E. coli)

Recombinant GFP (from E. coli)

Supplier: Creative Biomart

Recombinant GFP (from E. coli)

Expand 1 Items
Loading...
Human Recombinant EPAS1 (from E. coli)

Human Recombinant EPAS1 (from E. coli)

Supplier: Creative Biomart

Human Recombinant EPAS1 (from E. coli)

Expand 1 Items
Loading...

Human;Pig;Rat Viasoactive intestinal peptide

Supplier: Anaspec Inc

28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 2 Items
Loading...

Human Recombinant PD-1 (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS INC MS

Human PD-1/PDCD1 Full Length Protein, His Tag, Source: expressed from human 293 cells (HEK293). It contains AA Leu 25 - Leu 288, Predicted N-terminus: Leu 25, protein carries a polyhistidine tag at the C-terminus, Synonyms: PDCD1, PD1, CD279, SLEB2, Size: 500uG

Expand 1 Items
Loading...

Human Recombinant NCAM-1 (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS INC MS

Human NCAM-1/CD56 Protein, His Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 20 - Gly 718, Predicted N-terminus: Leu 20, protein carries a polyhistidine tag at the C-terminus, Synonyms: CD56, MSK39, NCAM1, N-CAM-1, Size: 100uG

Expand 1 Items
Loading...

Human Recombinant NOTCH2 (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS INC MS

Human NOTCH2 Protein, Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293). It contains AA Leu 26 - Gln 530, Predicted N-terminus: Leu 26, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: NOTCH2, hN2, N2ECD, Size: 100uG

Expand 1 Items
Loading...

C. botulinum Recombinant BoNT-D Light Chain (from E. coli)

Supplier: R&D Systems

The Recombinant Botulinum Neurotoxin Type D Light Chain from R&D Systems is derived from E. coli. The Recombinant Botulinum Neurotoxin Type D Light Chain has been validated for the following applications: Enzyme Activity.

Expand 1 Items
Loading...
Human Recombinant BMP2 (from E. coli)

Human Recombinant BMP2 (from E. coli)

Supplier: Creative Biomart

Human Recombinant BMP2 (from E. coli)

Expand 2 Items
Loading...

Mouse Recombinant ST7/LRP12 (from CHO cells)

Supplier: R&D Systems

The Recombinant Mouse ST7/LRP12 Protein from R&D Systems is derived from CHO. The Recombinant Mouse ST7/LRP12 Protein has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...
Recommended for You