You searched for: Proteins and Peptides

Supplier: Anaspec Inc

Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:LRRASLG
MW:771.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a H-2Db-restricted epitope from human Papillomavirus E7 protein (49-57).
Sequence:RAHYNIVTF
MW:1120.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a major histocompatibility complex class II (MHC-II)-restricted peptide, LLO190 (NEKYAQAYPNVS), from the listeriolysin O protein of Listeria monocytogenes, which generates an LLO190-specific Th response.
This peptide subsequently challenges recombinant L. monocytogenes expressing the MHC-I-restricted epitope of ovalbumin (Ova257, SIINFEKL).
Sequence:NEKYAQAYPNVS
MW:1383.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
MW: 3659.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: R&D Systems

The Recombinant Human IFN-alpha/beta R1 Protein from R&D Systems is derived from NS0. The Recombinant Human IFN-alpha/beta R1 Protein has been validated for the following applications: Bioactivity.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Anaspec Inc

This is a biotinylated CGRP with a long chain linker attached at the N-terminus end.
Sequence:Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:4128.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: ACROBIOSYSTEMS INC MS

Mouse Mesothelin / MSLN (298-600) Protein, His Tag (MALS verified), ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Cynomolgus Mesothelin / MSLN (296-580) Protein, His Tag (MALS verified), ACROBiosystems

Supplier: R&D Systems

The Recombinant Viral B8R Protein from R&D Systems is derived from CHO. The Recombinant Viral B8R Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human PlGF-3 Protein from R&D Systems is derived from Sf 21 (baculovirus). The Recombinant Human PlGF-3 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant B. pertussis Adenylate Cyclase Protein from R&D Systems is derived from E. coli. The Recombinant B. pertussis Adenylate Cyclase Protein has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec Inc

Cyclo(-RGDy-K) is labeled with HiLyte™ Fluor 750 (Abs/Em=754/778 nm). This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the a_vb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo[-RGDy-K(Hilyte Fluor™ 750)]
MW:1630.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

An H-2b-restricted OVA class II epitope.
Sequence: ISQAVHAAHAEINEAGR
MW: 1773.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: ACROBIOSYSTEMS INC MS

SARS-CoV-2 S1 protein NTD (A262S), His Tag (MALS verified), Source: expressed from HEK293. It contains AA Ser 13 - Leu 303, Predicted N-terminus: Ser 13, protein carries a polyhistidine tag at the C-terminus, Synonyms: S1 protein NTD, Spike protein S1 NTD, BetaCoV S1-NTD, Size: 100uG

Supplier: ACROBIOSYSTEMS INC MS

SARS-CoV-2 S1 protein NTD, His, Avitag* (MALS verified), Biotinylated, Source: expressed from HEK293. It contains AA Val 16 - Phe 318, Predicted N-terminus: Val 16, protein carries a polyhistidine tag at C-terminus, followed by an Avi tag, Synonyms: S1 protein NTD, Spike protein S1 NTD, Size: 200uG

Supplier: Anaspec Inc

This pro-apoptotic peptide, composed of D-amino acids, is a alpha-helical amphipathic peptide toxic to eukaryotic cells if internalized by a suitable targeting mechanism. It disrupts mitochondrial membranes upon receptor-mediated cell internalization and causes programmed cell death.
Sequence:klaklakklaklak-NH2
MW:1523 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: STEMCELL Technologies

Stimulating T cells with VZV (gE) Peptide Pool releases downstream cytokines and upregulates activation markers, enabling antigen-specific T cells to be detected or isolated for analysis. VZV (gE) Peptide Pool is a lyophilized mixture of 153 peptides from the envelope glycoprotein E (gE) of Varicella-zoster virus (VZV; strain Dumas), and consists of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1 - 623 on gE. gE is essential for VZV replication (Mo et al., 2002) and may contribute to viral pathogenesis by facilitating epithelial cell-cell contacts (Mo et al., 2000). Viral peptide pools are useful for a broad range of applications, including vaccine development, immunological research, and diagnostic assay development.

Supplier: STEMCELL Technologies

Stimulating T cells with EBV (GP350/340) Peptide Pool releases downstream cytokines and upregulates activation markers, enabling antigen-specific T cells to be detected or isolated for analysis. EBV (GP350/340) Peptide Pool is a lyophilized mixture of 224 peptides from envelope glycoprotein GP350 (GP350/340) of Epstein-Barr virus (EBV; strain B95-8), and consists of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1 - 907 on GP350/340. GP350 meditates EBV attachment to B lymphocytes via binding to the cell surface receptor CR2 (also known as C3d receptor or CD21) (Nemerow et al.; Tanner et al.). Viral peptide pools are useful for a broad range of applications, including vaccine development, immunological research, and diagnostic assay development.

Supplier: Anaspec Inc

This sequence is the hallmark of MUC1 mucin. MUC1 is a highly glycosylated type I transmembrane glycoprotein with a unique extracellular domain consisting of a variable number of tandem repeats (VNTR) of this 20 amino acid peptide It is overexpressed on the cell surface of many human adenocarcinomas and hematological malignancies, including multiple myeloma and B-cell lymphoma, making MUC1 broadly applicable target for immunotherapeutic strategies
Sequence:PDTRPAPGSTAPPAHGVTSA
MW:1887 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: R&D Systems

The Recombinant Human Cerebellin-1 Protein from R&D Systems is derived from CHO. The Recombinant Human Cerebellin-1 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human Neuronal Pentraxin 2 Protein from R&D Systems is derived from NS0. The Recombinant Human Neuronal Pentraxin 2 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse Plexin B2 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Plexin B2 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Rat CCL3/MIP-1 alpha Protein from R&D Systems is derived from E. coli. The Recombinant Rat CCL3/MIP-1 alpha Protein has been validated for the following applications: Bioactivity.