You searched for: Proteins and Peptides

Supplier: R&D Systems

The Recombinant Mouse Draxin Protein from R&D Systems is derived from NS0. The Recombinant Mouse Draxin Protein has been validated for the following applications: Bioactivity.

Supplier: Anaspec Inc

This is an N-terminal biotin-labeled OVA Peptide, amino acids 323 to 339. This peptide is an H-2b-restricted OVA class II epitope.
Sequence: Biotin-ISQAVHAAHAEINEAGR
MW: 2000.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is histone H4 (1-25) with acetylation at Lys12 and Lys16. It is biotinylated through a C-terminal GSGSK linker. It has been shown that human histone H4 is preferentially acetylated first at Lys16, then at Lys12. Diacetylated histone H4 has been shown to bind repressor protein TUP1. Acetylation of histone H4 also regulates heterochromatin formation by promoting the binding of bromodomains to p300 and transcription factor TAFII250 and inhibiting interactions with SIR3. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3316.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Mouse NELL1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse NELL1 Protein has been validated for the following applications: Bioactivity.

Supplier: STEMCELL Technologies

Stimulating T cells with VZV (gE) Peptide Pool releases downstream cytokines and upregulates activation markers, enabling antigen-specific T cells to be detected or isolated for analysis. VZV (gE) Peptide Pool is a lyophilized mixture of 153 peptides from the envelope glycoprotein E (gE) of Varicella-zoster virus (VZV; strain Dumas), and consists of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1 - 623 on gE. gE is essential for VZV replication (Mo et al., 2002) and may contribute to viral pathogenesis by facilitating epithelial cell-cell contacts (Mo et al., 2000). Viral peptide pools are useful for a broad range of applications, including vaccine development, immunological research, and diagnostic assay development.

Supplier: R&D Systems

The Recombinant Human ADAM22 Protein from R&D Systems is derived from CHO. The Recombinant Human ADAM22 Protein has been validated for the following applications: Bioactivity.

Supplier: STEMCELL Technologies

Stimulating T cells with EBV (GP350/340) Peptide Pool releases downstream cytokines and upregulates activation markers, enabling antigen-specific T cells to be detected or isolated for analysis. EBV (GP350/340) Peptide Pool is a lyophilized mixture of 224 peptides from envelope glycoprotein GP350 (GP350/340) of Epstein-Barr virus (EBV; strain B95-8), and consists of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1 - 907 on GP350/340. GP350 meditates EBV attachment to B lymphocytes via binding to the cell surface receptor CR2 (also known as C3d receptor or CD21) (Nemerow et al.; Tanner et al.). Viral peptide pools are useful for a broad range of applications, including vaccine development, immunological research, and diagnostic assay development.

Supplier: Anaspec Inc

This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is biotinylated in N-term, with a LC linker.
Sequence:Biotin-LC-FFKNIVTPRTPPPSQGK-NH2
MW:2252.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: R&D Systems

The Recombinant Mouse LRP-5 Protein from R&D Systems is derived from HEK293. The Recombinant Mouse LRP-5 Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Human FGF acidic, Animal-Free Protein from R&D Systems is derived from E. coli. The Recombinant Human FGF acidic, Animal-Free Protein has been validated for the following applications: Bioactivity.

Supplier: Anaspec Inc

In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Supplier: ACROBIOSYSTEMS INC MS

Human LAG-3 / CD223 Protein, His Tag, low endotoxin, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human LILRB4 / CD85k / ILT3 Protein, His Tag (SPR verified), ACROBiosystems

Supplier: R&D Systems

The Recombinant Human ULBP-5 Protein from R&D Systems is derived from CHO. The Recombinant Human ULBP-5 Protein has been validated for the following applications: Bioactivity.

Supplier: Anaspec Inc

This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: ACROBIOSYSTEMS INC MS

Human Alpha-Synuclein Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Rabbit Complement C5 Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human NKG2C / CD159c Protein, His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human IgG1 Fc Protein, Flag Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Biotinylated Cynomolgus PD-1 / PDCD1 Protein, His,Avitag™, ACROBiosystems

Supplier: R&D Systems

The Recombinant Human UbcH5c/UBE2D3 Protein from R&D Systems, powered by R&D Systems, powered by Boston Biochem is derived from E. coli. The Recombinant Human UbcH5c/UBE2D3 Protein has been validated for the following applications: Enzyme Activity.

Supplier: ACROBIOSYSTEMS INC MS

Mouse ICOS / CD278 (C137S, C138S) Protein, Fc Tag, ACROBiosystems

Supplier: R&D Systems

The Recombinant Human SPINK1 Protein from R&D Systems is derived from E. coli. The Recombinant Human SPINK1 Protein has been validated for the following applications: Enzyme Activity.

Supplier: Anaspec Inc

KALA is a cationic amphipathic cell-penetrating peptide (CPP). It assumes an alpha-helix conformation when the pH is 7.5. KALA binds oligonucleotides and disrupts cell membrane; therefore, it can be used as a DNA transfection reagent.
Sequence:WEAKLAKALAKALAKHLAKALAKALKACEA
MW:3131.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a heptapeptide from the N-terminal prion-determining domain of the yeast protein Sup35 that forms amyloid fibrils. The availability of its detailed atomic oligomeric structure makes it a good model for studying the early stage of aggregation. The GNNQQNY dimer forms three stable sheet structures. in-register parallel, off-register parallel, and anti-parallel. The in-register parallel dimer, which is close to the amyloid beta-sheet structure, has few interpeptide hydrogen bonds, making hydrophobic interactions more important and increasing the conformational entropy compared to the anti-parallel sheet.
Sequence: GNNQQNY
Molecular Weight: 836.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: R&D Systems

The Recombinant Mouse IGF-I R Protein from R&D Systems is derived from CHO. The Recombinant Mouse IGF-I R Protein has been validated for the following applications: Bioactivity.

Supplier: R&D Systems

The Recombinant Mouse sFRP-5 Protein from R&D Systems is derived from CHO. The Recombinant Mouse sFRP-5 Protein has been validated for the following applications: Bioactivity.

Supplier: ACROBIOSYSTEMS INC MS

Human CD24 Protein, Fc Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS INC MS

Human EphA4 Protein, His Tag, ACROBiosystems