You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Human Recombinant Fc gamma RI / CD64 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant Fc gamma RI / CD64 (from HEK293)
Expand 1 Items
Human Recombinant CD200 R1 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant CD200 R1 (from HEK293)
Expand 1 Items
Human Recombinant ALKBH3
Supplier: Creative Biomart
Human Recombinant ALKBH3
Expand 1 Items
Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) fbpA (from E. coli)
Supplier: Creative Biomart
Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) fbpA (from E. coli)
Expand 2 Items
Recombinant Protein A (from E. coli)
Supplier: Creative Biomart
Recombinant Protein A (from E. coli)
Expand 1 Items
Recombinant GST (from E. coli)
Supplier: Creative Biomart
Recombinant GST (from E. coli)
Expand 4 Items
Abltide
Supplier: Anaspec Inc
Abltide is a peptide substrate for Abl Kinase (Abl protein tyrosine kinase), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus. Used in Western blot and kinase assay.
Sequence:KKGEAIYAAPFA-NH2
MW:1264.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
GRGDSP Peptide
Supplier: Anaspec Inc
An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Anti-BetaGamma
Supplier: Anaspec Inc
This is a membrane-permeable peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminus of phosducin-like protein.
Sequence:AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
MW:4601.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Rabies virus Rabies virus strain flury lep antigen (propiolactone inactivated)
Supplier: Creative Biomart
Rabies virus inactivated antigen, A.
Expand 1 Items
Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)
Supplier: Creative Biomart
Human Papilloma Virus 52 (HPV-52) Recombinant HPV52-L1 (from E. coli)
Expand 1 Items
Recombinant Human GPC4 (from E. coli)
Supplier: Creative Biomart
Recombinant Human GPC4 (from E. coli)
Expand 2 Items
Recombinant Human ARG2 (from E. coli)
Supplier: Creative Biomart
Recombinant Human ARG2 (from E. coli)
Expand 2 Items
Recombinant Human F13A1 (from E. coli)
Supplier: Creative Biomart
Recombinant Human F13A1 (from E. coli)
Expand 1 Items
Recombinant Human DDX53 (from E. coli)
Supplier: Creative Biomart
Recombinant Human DDX53 (from E. coli)
Expand 1 Items
Human Recombinant EPAS1 (from E. coli)
Supplier: Creative Biomart
Human Recombinant EPAS1 (from E. coli)
Expand 1 Items
Human Recombinant BMP2 (from E. coli)
Supplier: Creative Biomart
Human Recombinant BMP2 (from E. coli)
Expand 2 Items
Human Recombinant INS (from E. coli)
Supplier: Creative Biomart
Human Recombinant INS (from E. coli)
Expand 1 Items
Human Recombinant AR (from E. coli)
Supplier: Creative Biomart
Human Recombinant AR (from E. coli)
Expand 2 Items
Human Recombinant CBX3 (from E. coli)
Supplier: Creative Biomart
Human Recombinant CBX3 (from E. coli)
Expand 1 Items
Human Recombinant DPYSL5 (from E. coli)
Supplier: Creative Biomart
Human Recombinant DPYSL5 (from E. coli)
Expand 1 Items
Human Recombinant BLNK (from E. coli)
Supplier: Creative Biomart
Human Recombinant BLNK (from E. coli)
Expand 1 Items
Human Native C4BPB (from Plasma)
Supplier: Creative Biomart
Human Native C4BPB (from Plasma)
Expand 1 Items
Human Recombinant CDK8 (from E. coli)
Supplier: Creative Biomart
Human Recombinant CDK8 (from E. coli)
Expand 1 Items
Human Recombinant CD3E and CD3D
Supplier: Creative Biomart
Human Recombinant CD3E and CD3D
Expand 5 Items
Human Recombinant FOXA1 (from E. coli)
Supplier: Creative Biomart
Human Recombinant FOXA1 (from E. coli)
Expand 2 Items
Recombinant Human IL6 (from E. coli)
Supplier: Creative Biomart
Recombinant Human IL6 (from E. coli)
Expand 1 Items
Recombinant E.coli DnaK (from E. coli)
Supplier: Creative Biomart
Recombinant E.coli DnaK (from E. coli)
Expand 1 Items
Human Recombinant CLEC11A (from E. coli)
Supplier: Creative Biomart
Human Recombinant CLEC11A (from E. coli)
Expand 1 Items
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: VWR International
Supplier: BDH