You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Rat C-Peptide-2
Supplier: Anaspec Inc
This rat C-peptide-2 differs from the active human C-peptide by several amino acids, however conserved Glu at positions 3, 11, and 27 is essential for peptide activity. In rat medullary thick ascending limb, C-peptide stimulates Na+,K+-ATPase activity within a physiological concentration range. This effect is due to an increase in Na+,K+-ATPase turnover rate that is most likely mediated by protein kinase C-f phosphorylation of the Na+,K+-ATPase f-subunit.
Sequence: EVEDPQVAQLELGGGPGAGDLQTLALEVARQ
MW: 3161.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
[Glu3]-RGES, Control for RGD Peptides
Supplier: Anaspec Inc
This peptide is a control for the RGDS Fibronectin Active Fragment and other RGD-related peptides. Asp3 is replaced by Glu3 in RGDS peptide changing its properties to inhibit integrins and proteins of extracellular matrix binding.
Sequence:RGES
MW:447.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Supplier: Anaspec Inc
This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Interphotoreceptor Retinoid Binding Protein Fragment
Supplier: Anaspec Inc
This 20-residue peptide, a major pathogenic T-cell epitope (161–180), is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP). It has been shown to induce posterior uveitis (EAU).
Sequence:SGIPYIISYLHPGNTILHVD
MW:2209.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
Autocatamide-2 Peptide
Supplier: Anaspec Inc
The native peptide KKALRRQETVDAL (60249-1) is a selective substrate for Ca2+/calmodulin-dependent protein kinase (CaMK). The fluorescent and biotinylated peptides are used to design assays for CaMKs.
Sequence:KKALRRQETVDAL
MW:1527.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 2 Items
E. coli Recombinant gldA (from E. coli)
Supplier: Creative Biomart
E. coli Recombinant gldA (from E. coli)
Expand 2 Items
Human Recombinant Fc gamma RI / CD64 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant Fc gamma RI / CD64 (from HEK293)
Expand 1 Items
Recombinant Protein A (from E. coli)
Supplier: Creative Biomart
Recombinant Protein A (from E. coli)
Expand 1 Items
Recombinant Protein G (from E. coli)
Supplier: Creative Biomart
Recombinant Protein G (from E. coli)
Expand 1 Items
Recombinant Human FZD6 (from HEK293 cells)
Supplier: Creative Biomart
Recombinant Human FZD6 (from HEK293 cells)
Expand 1 Items
Recombinant Human IL1B (from E. coli) R-PE
Supplier: Creative Biomart
Recombinant Human IL1B (from E. coli) R-PE
Expand 1 Items
Recombinant Rhesus monkey CLEC9A (from HEK293 cells)
Supplier: Creative Biomart
Recombinant Rhesus monkey CLEC9A (from HEK293 cells)
Expand 1 Items
Human Papilloma Virus 6 (HPV-6) Recombinant E6 (from E. coli)
Supplier: Creative Biomart
Human Papilloma Virus 6 (HPV-6) Recombinant E6 (from E. coli)
Expand 1 Items
Rhesus macaque Recombinant LAIR-1 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Rhesus macaque Recombinant LAIR-1 (from HEK293)
Expand 1 Items
Recombinant Hepatitis B Virus HBcAg (from Pichia pastoris)
Supplier: Creative Biomart
Recombinant Hepatitis B Virus HBcAg (from Pichia pastoris)
Expand 1 Items
Human Recombinant ALB (from Rice grain)
Supplier: Creative Biomart
Human Recombinant ALB (from Rice grain)
Expand 3 Items
Recombinant Human JAG1 (from HEK293 cells)
Supplier: Creative Biomart
Recombinant Human JAG1 (from HEK293 cells)
Expand 3 Items
Human Recombinant CD19 (from HEK293 cells)
Supplier: Creative Biomart
Human Recombinant CD19 (from HEK293 cells)
Expand 2 Items
Human Recombinant CCND1 (from HEK293 cells)
Supplier: Creative Biomart
Human Recombinant CCND1 (from HEK293 cells)
Expand 1 Items
Human Recombinant LRRK2 (from Mammalian cells)
Supplier: Creative Biomart
Human Recombinant LRRK2 (from Mammalian cells)
Expand 1 Items
Recombinant Human CLCA1 (from Wheat Germ)
Supplier: Creative Biomart
Recombinant Human CLCA1 (from Wheat Germ)
Expand 1 Items
Human Recombinant IgG1 Fc (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant IgG1 Fc (from HEK293)
Expand 1 Items
Human Recombinant B7-H6 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant B7-H6 (from HEK293)
Expand 1 Items
Human Recombinant HLA-G (from HEK293T cells)
Supplier: Creative Biomart
Human Recombinant HLA-G (from HEK293T cells)
Expand 2 Items
Human Recombinant Integrin alpha 4 beta 1 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant Integrin alpha 4 beta 1 (from HEK293)
Expand 1 Items
Mouse Recombinant B7-H3 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Mouse Recombinant B7-H3 (from HEK293)
Expand 1 Items
Beta-Amyloid A4 Protein Precursor (740-770)
Supplier: Anaspec Inc
APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Mouse Recombinant OX40 Ligand (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Mouse Recombinant OX40 Ligand (from HEK293)
Expand 1 Items
Human Recombinant PD-L2 (from HEK293)
Supplier: ACROBIOSYSTEMS INC MS
Human Recombinant PD-L2 (from HEK293)