Order Entry
Canada
ContactUsLinkComponent
 

You searched for: Proteins and Peptides

Proteins and Peptides

Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.

Human PLP

Supplier: Anaspec Inc

This serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice.
Sequence: HSLGKWLGHPDKF
MW: 1521.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Human gp100 (25–33) peptide

Supplier: Anaspec Inc

This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific, H-2Db-restricted, CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
MW: 1155.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

[Lys(Ac)8]-Histone H4 (1-21)-GGK,Biotin

Supplier: Anaspec Inc

This peptide is histone H4, amino acids 1 to 21. It is acetylated at Lys-8 and at the N-terminus with a C-terminus GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that amplify the binding of transcription factors to their recognition sites within the nucleosome.
Sequence:Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

[Lys(Me2)36]-Histone H3 (26-46)

Supplier: Anaspec Inc

This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

TNF-alpha Antagonist

Supplier: Anaspec Inc

This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

[Lys(Me3)4]-Histone H3 (1-25)

Supplier: Anaspec Inc

This synthetic peptide corresponds to amino acids 1-25 of human histone H3. It is trimethylated at lysine 4. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2
MW:2667.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human MUC5AC-13

Supplier: Anaspec Inc

This glycopeptide is an N-acetyl galactosamine (GalNAc)-modified MUC5AC mucin peptide containing the single site of threonine 13 labeled with GalNAc (T*). Polypeptide N-acetylgalactosaminyltransferase (ppGaNTase) catalyzes the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to threonine. The MUC5AC gene is mainly expressed in gastric and tracheo-bronchial mucosae, and some tumors.
Sequence:GTTPSPVPTTST-T*-SAP (* = GalNAc-modified residue)
MW:1704.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

37, 40 GAP26, Connexin Mimetic

Supplier: Anaspec Inc

This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins (Cx37, Cx40), designated as 37,40Gap 26 according to Cx homology. It was used to investigate the role of gap junctions in the spread of endothelial hyperpolarizations evoked by cyclopiazonic acid (CPA) through the wall of the rodent iliac artery. The gap junction plaques constructed from Cx37 and Cx40 were abundant in the endothelium. This peptide provides inhibitory effects against subintimal hyperpolarization
Sequence:VCYDQAFPISHIR
MW:1548.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Rana Temporaria Temporin A

Supplier: Anaspec Inc

Temporin A is a highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria. This antimicrobial peptide exerts its effect by inducing the migration of human monocytes, macrophages, and neutrophils, thus modulating the permeability of the microbial membrane to allow passage of various-sized molecules and exhibiting activity against gram-positive bacteria, particularly antibiotic-resistant gram-positive cocci. Temporin A activity is enhanced when used in combination with other antimicrobial agents.
Sequence:FLPLIGRVLSGIL-NH2
MW:1396.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Recombinant Irisin (from CHO cells)

Supplier: Adipogen

Irisin is a recently described exercise-induced hormone secreted by skeletal muscle in mice and humans. Irisin activates beige fat cells (beige cells have a gene expression pattern distinct from either white or brown fat and are preferentially sensitive to the polypeptide hormone Irisin). Irisin is cleaved from the type I membrane protein FNDC5 and improves systemic metabolism by increasing energy expenditure.

Expand 2 Items
Loading...

Human Recombinant Jagged-2 (from HEK293 cells)

Supplier: Adipogen

Jagged-2 is a putative Notch ligand involved in the mediation of Notch signaling, that can induce stromal cells to secrete IL-6, VEGF and IGF-1. Notch activation can interact with NF-kappaB and C-myc to promote the proliferation and to inhibit the apoptosis of MM cells, showing in the relationship between the incidence of myeloma and drug resistance. Jagged-2 is also involved in limb development.

Expand 1 Items
Loading...

[Lys(Me3)79]-Histone H3(73-83)

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 73 to 83 tri-methylated at Lysine 79. Histone lysine methylation plays a role in transcriptional regulation. H3K79 can be methylated by Dot1 methyltransferase.Related Peptides: Histone H3 (73-83), Cat# 65437 [Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac), Cat# 65438 [Lys(biotin)79]-Histone H3 (73-83), H3K79(biotin), Cat# 65440
Sequence:EIAQDF-K(Me3)-TDLR
MW:1378.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Cyclo (-RGDfK)

Supplier: Anaspec Inc

In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to alpha-v/beta-3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence.
Sequence:Cyclo(-RGDfK)
MW:603.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Recombinant Lymphotoxin beta R/TNFRSF3 (from CHO Cells)

Supplier: R&D Systems

The Recombinant Human LT beta R/TNFRSF3 Fc Chimera (CHO) from R&D Systems is derived from CHO. The Recombinant Human LT beta R/TNFRSF3 Fc Chimera (CHO) has been validated for the following applications: Bioactivity.

Expand 1 Items
Loading...

Human Beta-Amyloid (3-42)

Supplier: Anaspec Inc

This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
Loading...

Pig Protegrine-1 (PG-1)

Supplier: Anaspec Inc

This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

G209-2M, gp100 (209-217)

Supplier: Anaspec Inc

This modified gp100 peptide amino acids 209 to 217 is a MHC-associated HLA-A2.1-restricted epitope derived from melanoma antigen. It can be processed, presented, and recognized by T cells. Alteration of the G209 peptide to G209-2M at the second amino acid changing threonine to a methionine was found to increase the affinity for MHC-associated HLA-A2.1 resulting in enhanced induction of T cells reactive to native gp100
Sequence:IMDQVPFSV
MW:1035.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Histone H3 (1-21), K4 Methylated, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This is a FAM (Abs/Em = 492/518 nm) labeled histone 3 (H3) amino acid residues 1 to 21 with lysine 4 methylated.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2868.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...
SARS-CoV-2 Recombinant Nucleocapsid Protein, aa1-419 (E. coli expressed)

SARS-CoV-2 Recombinant Nucleocapsid Protein, aa1-419 (E. coli expressed)

Supplier: STEMCELL Technologies

SARS-CoV-2 Recombinant Nucleocapsid Protein, aa1-419 is expressed in E. coli and is one of four structural proteins encoded by the SARS-CoV-2 genome. The Nucleocapsid Protein is transcribed from the viral “N” gene and is the protein that interacts with RNA to form the nucleocapsid. The protein is a homo-oligomer, and both the monomer and the oligomer can interact with RNA. This protein also interacts with the membrane protein (protein M) after infection of the host cell during packaging of the positive-strand viral genome RNA into the ribonucleocapsid during virion assembly. At the amino terminus, SARS-CoV-2 Recombinant Nucleocapsid Protein contains a thrombin site, a T7 tag, and a polyhistidine tag.

Expand 1 Items
Loading...

[Lys(Ac)9]-Histone H3 (1-21)-NH2,Biotin

Supplier: Anaspec Inc

This is a biotin labeled H3K9(Ac) Histone. H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

[Lys(Ac)9]-Histone H3 (1-24)

Supplier: Anaspec Inc

This Histone 3 peptide is acetylated at lysine residue at 9th position. In a glioblastoma xenograft expressing a O6-methylguanine-DNA methyltransferase (MGMT), increased H3K9-ac was observed in correlation to histone acetylation and MGMT upregulation, thus demonstrating a mechanism driven by chromatin-mediated MGMT upregulation in potentially directing epigenetic therapies to influence the mechanisms of resistance development in glioblastomas.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLATKA
MW:2597 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SMCC Activated CL - APC

Supplier: Anaspec Inc

Cross-linked Allophycocyanin (CL-APC), highly fluorescent stabilized phycobiliprotein, is chemically modified with SMCC. SMCC reacts with the primary amine on CL-APC and introduces maleimide groups to APC. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of APC with proteins. These conjugates are widely used in applications such as flow cytometry, live cell staining, and immunofluorescent staining.

Expand 1 Items
Loading...

Human CD273 (from CHO cells)

Supplier: Adipogen

CD273 (B7-DC; PD-L2) is a type I surface molecule with homology to CD80, CD86, CD274. It is expressed primarily by dendritic cells and provides a stimulatory signal to CD279 (PD-1; programmed death molecule) which has an important immunoregulatory role by downregulating the T cell response. CD273 binds to CD279 (PD-1) with a 2-6 fold higher affinity than CD274.

Expand 1 Items
Loading...

Human [Asn7]-beta-Amyloid (1-42)

Supplier: Anaspec Inc

This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

Lymphocytic Choreomeningitis Virus (LCMV) 276-286

Supplier: Anaspec Inc

This peptide is amino acids 276 to 286 fragment of the lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), also known as GP276. It is the H-2Db restricted epitope. LCMV has been routinely exploited for the study of adaptive immune responses to viral infection. Fifty to seventy percent of CD8 T cells at the peak of LCMV infection appear to be specific for five LCMV-derived epitopes including GP276.
Sequence:SGVENPGGYCL
MW:1095.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

IL-8 Inhibitor

Supplier: Anaspec Inc

This hexapeptide, acetylated on the amino terminus and amidated on the carboxyl terminus, inhibits the specific binding of 125I-IL-8 to neutrophils. IL-8 is a member of the chemokine alpha subfamily that activates neutrophils and is chemotactic for these cells. IL-8 Inhibitor also suppresses the binding of macrophage inflammatory protein 2 (MIP 2) beta to neutrophils.
Sequence:Ac-RRWWCR-NH2
MW:1003.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Rat Brain Natriuretic Peptide 45

Supplier: Anaspec Inc

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Recombinant MMP-1 (from E. coli)

Supplier: Anaspec Inc

Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. MMP-1 digests a broad range of substrates, including α-1 antitrypsin, myelin basic protein, collagen I, II, III, VII, VIII, casein, gelatin, and others

Expand 2 Items
Loading...

Histone H3 (1-20)

Supplier: Anaspec Inc

This is amino acids 1 to 20 fragment of the histone H3. Comparison the acetylation efficiency of different substrates showed that this peptide corresponding to the N-terminal of H3 histone has nearly identical acetylation efficiency as the H4 peptides. Acetylation of histones is generally associated with active transcription, constitutes a post-translational mark recognized by specific chromatin factors, and has been shown in vitro to prevent salt-induced folding of nucleosome arrays. Multisubunit histone acetyltransferase (HAT) complexes recognize and perform efficient acetylation on nucleosome substrates.
Sequence:ARTKQTARKSTGGKAPRKQL
MW:2183.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Rat Adrenomedullin (1-50)

Supplier: Anaspec Inc

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...
Recommended for You